KEGG   Edwardsiella piscicida C07-087: ETAC_00930Help
Entry
ETAC_00930        CDS       T02509                                 

Definition
(GenBank) 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase
  KO
K05966  triphosphoribosyl-dephospho-CoA synthase [EC:2.4.2.52]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_00930
Enzymes [BR:etc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.52  triphosphoribosyl-dephospho-CoA synthase
     ETAC_00930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CitG
Motif
Other DBs
NCBI-ProteinID: AGH72319
Position
complement(229052..229963)
Genome map
AA seq 303 aa AA seqDB search
MQHPTTYSPHHLSLSQACRHYATLGWRAMLAEVNLTPKPGLVDRHNSGAHRDMAHSDFVR
SADAIAPWLARFVEYGADSAALDGGSVLPGLRALGIACEADMFRATAGVNTHKGSIFSLG
LLCAAAGRSHQRGHPITPARLCGYAAQFCRGLVARELAPLRPAQASTAGQRLFMTLGITG
ARGEAEAGYPLVLNLALPHYQRTLAAGRDPELALLDTLVQLMAHNQDTNVAARGGEDGLR
WMQQRAAALLATGGIRTPADLQALRRFDAECIDRHLSPGGSADLLILTWFLAHLCYPILQ
AEH
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacccgacaacgtatagtccgcatcacctttccctgagccaggcctgtcgccac
tatgccacgctgggctggcgcgccatgctggccgaggtcaatctgacgcccaaaccgggg
ctggtcgatcgccacaacagcggcgcccaccgcgacatggcccacagcgactttgtgcgc
agcgccgatgccatcgccccctggctggctcgctttgtcgaatacggcgccgacagcgcc
gcgctggacggcggcagcgtattgcccggcctgcgcgcgctcggcatcgcctgcgaggcg
gacatgttccgcgcgaccgccggcgtcaatacccataagggcagcatcttttctctcggc
ctgctgtgcgccgccgccgggcgcagccaccagcgcggccaccccattacccccgcgcgg
ctgtgcggctatgcggctcagttttgccgcgggctggtcgcgcgcgagctggctcccctg
cgcccggcgcaggcgtccacggccggacagcgtctgtttatgacgctgggcattaccggc
gcccgcggcgaggcggaggccggctaccccctggtgctgaatctggcgcttccccattac
cagcggacgctggccgccggacgcgatccggagctggcgctgctcgataccctggtgcag
ctgatggcgcataaccaggataccaatgtcgcggcgcgcggcggcgaggacgggctgcgc
tggatgcaacagcgcgccgccgcgctactggcaaccggcggcatccgcaccccggccgat
ctgcaggcgctacgccgctttgacgccgagtgtattgaccgtcacctgagcccgggcggc
agcgcggatctgctgatcctcacctggtttctggctcacctctgttacccgattttgcaa
gctgaacattaa

DBGET integrated database retrieval system