KEGG   Edwardsiella piscicida C07-087: ETAC_00935Help
Entry
ETAC_00935        CDS       T02509                                 

Gene name
citX
Definition
(GenBank) 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA:apo-citrate lyase
  KO
K05964  holo-ACP synthase [EC:2.7.7.61]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_00935 (citX)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.61  citrate lyase holo-[acyl-carrier protein] synthase
     ETAC_00935 (citX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CitX DUF4675 Prim-Pol
Motif
Other DBs
NCBI-ProteinID: AGH72320
Position
complement(229941..230492)
Genome map
AA seq 183 aa AA seqDB search
MMTLLPHLAASHTVTLPELLLSRECRQSRQAAWLTRHTCTLISFTVVAPGPVKDSPLTRR
IFNAGIAALNQLAQRQEWPLREQRSLELATGPEGLMAIDAPAEQVKRAAIALEQAHPLGR
LWDMDVLASDGQILSRSDYQLPARRCLICQRPAVLCARERRHDVAQLLAHMEALVHDATP
DNV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccctgctcccccatttggcggccagccataccgtcaccctaccggaactgctc
ctcagccgtgaatgcaggcagtcccggcaggcggcatggctgacccgccatacctgtacg
ctgatctcctttaccgtggtcgcccccggcccggtcaaggatagcccgctgacgcgccgc
atcttcaatgcgggcatcgcggcgctgaaccagctagcacagcgtcaggaatggcccctg
cgggagcagcgttcactggagttagccaccggcccggaagggctgatggccatcgatgcg
ccggccgagcaggtcaaacgggcggccatcgcactggagcaggcccaccccctgggtcgg
ctctgggatatggatgtcttggccagcgacggacagatcctgtcgcgcagcgattatcag
ctgccggcccgccgctgcctgatttgccaacgccccgccgtgctgtgcgcccgcgagcgc
cgccacgacgtggcccaacttctcgcccatatggaggcactggttcacgatgcaacaccc
gacaacgtatag

DBGET integrated database retrieval system