KEGG   Edwardsiella piscicida C07-087: ETAC_00940Help
Entry
ETAC_00940        CDS       T02509                                 

Definition
(GenBank) citrate lyase subunit alpha
  KO
K01643  citrate lyase subunit alpha / citrate CoA-transferase [EC:2.8.3.10]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_00940
Enzymes [BR:etc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.10  citrate CoA-transferase
     ETAC_00940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CitF AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AGH72321
Position
complement(230496..232016)
Genome map
AA seq 506 aa AA seqDB search
MTQDTQRNARVAAFSQRDGALPAFNDVSKAQYHDGRARDRKLCTSLEEAIRRSGLRDGMT
ISFHHAFRGGDLTLNQVMDAIAAMGFKDLTLASSSLSDCHAPLVGHIRNGVVRKIYTSGL
RGPLADAVSHGLLDEPVQIHSHGGRVHLIDSGELSIDVAFLGVPACDAFGNANGYTGNAC
CGSLGYARADAEAANSVVLLTEEILPYPHNPASLTQDQVDLIVQIDHVGDASKIGADATR
MTSNPRELLIARSAAEVIAHSGYFNEGFSLQTGTGGASLAVTRFLEDKMRRADIRADFAL
GGITSTIVDLHEKGYIRKLLDVQSFDRAAAGSLARNPNHIEISANQYANWSSKGASVDRL
DVVVLSALEVDTHFNVNVLTGSDGVLRGASGGHCDTAIGSALSIIVAPLVRGRIPTIVDS
VLTCVTPGSSIDILVTDHGIAVNPARPELAQRLRDAGLPLVSIEWLRDRALSLTGEPKPI
AFTDKVVAVVRYRDGSVIDVVRQVKE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagatacccaacgaaacgcccgcgtagccgcctttagccaacgggacggcgcg
ctgccggccttcaacgacgtcagcaaggcgcagtaccacgacggtcgcgcgcgcgatcgc
aagctgtgcacctctctggaagaggccatccgtcgcagcggcctgcgcgacggcatgacc
atctccttccaccacgccttccgcggcggcgatctgaccctgaatcaggtgatggacgcc
atcgccgccatgggcttcaaagatctgaccctggcctccagctccctgagcgactgccat
gcgccgctggtcggccatattcgcaatggcgtggtacgcaagatctacacctctggcctg
cgcggcccgctggctgacgccgtctcccacggcctgctcgacgaaccggtgcagatccac
tcccacggtggccgagtgcacctgatcgacagcggcgagctgagcatcgacgtcgccttt
ctcggggtgccggcctgcgacgccttcggtaacgccaacggctataccggcaacgcctgc
tgcgggtcgctgggctacgcccgcgccgatgccgaagcggccaacagcgtcgtcctgctg
accgaggagattctgccttacccgcacaacccggccagcctgacgcaagaccaggtcgat
ctgatcgtccagatcgatcacgtcggcgacgccagcaagatcggcgctgatgccacccgc
atgacctctaacccgcgtgagctgctgatcgcccgcagcgcagcagaagtaatcgctcac
tccggttactttaacgagggcttctcgctgcagaccggcaccggcggcgcctcactggcc
gtgacccgcttcttggaagacaagatgcgtcgcgccgatattcgcgccgactttgccctg
ggcggcattacctccaccatcgtcgatctgcacgagaagggatacatccgtaagctgctt
gatgtgcagagcttcgaccgcgccgccgcgggctccctggcacgcaacccgaaccacatc
gaaatcagcgccaaccaatacgccaactggagctccaaaggcgcatcggtcgaccgtctt
gacgtggtggtgctgagcgcgctggaagtggacactcacttcaacgttaacgtcctgacc
ggctccgacggcgttctgcgcggtgcctccggcggccactgcgacaccgccatcggctcc
gcgctctccatcatcgtggcgccgctggtgcgcggacgcataccgaccatcgtcgatagc
gtgctgacctgcgtcacccccggctccagtatcgacatcctggtcaccgaccacggcatc
gccgtcaacccggcgcgcccggagctggcgcagcgtctgcgcgacgccggcctgccgttg
gtcagcatcgagtggctgcgcgatcgcgcgctctccctaaccggcgagccgaagccgatc
gcctttaccgacaaggttgtggccgtggtgcgctaccgcgatggcagcgttattgacgtg
gttcgccaggtcaaggaataa

DBGET integrated database retrieval system