KEGG   Edwardsiella piscicida C07-087: ETAC_00945Help
Entry
ETAC_00945        CDS       T02509                                 

Definition
(GenBank) citrate lyase subunit beta
  KO
K01644  citrate lyase subunit beta / citryl-CoA lyase [EC:4.1.3.34]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_00945
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.34  citryl-CoA lyase
     ETAC_00945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: AGH72322
Position
complement(232027..232923)
Genome map
AA seq 298 aa AA seqDB search
MTPQQKTRTRRSMLFVPGSNAAMLSNAFIYKADALMFDLEDSVVLREKDAARRLVYHALQ
HPLYHDIETIVRVNALDSAYGVADLEAVVRAGVDVVRLPKTDSADDVIAIENEIARIERA
CGREVGSTGLLAAIESAQGITQAVAIAHASPRLIGIALGAEDYVRNLRTERSAEGIELLF
ARCSILQAARSAGIQAFDTVYSDANNDEGFLREASHIKQLGFDGKSLINPRQIELLHNLY
APTQKEVDHARLVVDAAEASAREGRGVVSLNGKMVDSPVIERARLVLSRAALSGIREE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcaacagaaaacccgcacccgtcgcagcatgctgtttgttcccggctccaac
gccgccatgctgagcaacgcctttatctataaagccgatgcgctgatgtttgacctggag
gactccgtggtgctgcgtgaaaaagacgccgcccgccgtctggtctaccacgcgctgcag
catcccctgtaccacgatatcgaaaccatcgtgcgcgtgaatgccctggactctgcgtac
ggcgtcgccgatctcgaggccgtcgtgcgcgccggcgttgacgtcgtgcgcctgccgaaa
accgactcggccgacgacgtcatcgctatcgaaaacgaaatcgcccgcatcgaacgtgcc
tgcggacgcgaggtgggcagcaccggtctgctggccgccatcgagtcagcccaggggatc
acccaggccgtggccatcgcccacgcctccccgcgtctgatcgggattgcgctcggcgcc
gaagactatgtgcgcaatctgcgcacggagcgctcggcagagggcatcgaactgctgttc
gcccgctgcagcatcctgcaggcggcccgctccgccggcatccaggcctttgacaccgtc
tactccgatgccaacaacgatgagggcttcctgcgcgaagcgtcccatatcaaacagctg
ggctttgacggtaaatcgctgatcaacccgcgtcagatcgagctgctgcacaacctgtac
gcgccgacgcagaaagaggtcgatcacgcccgtctggtggtcgacgccgccgaagcctcc
gcccgcgaaggacgcggcgtggtttccctgaacggcaagatggttgacagcccggtgatc
gagcgcgcgcgtctggtactttcccgcgcggccctgtccggcatccgtgaagaataa

DBGET integrated database retrieval system