KEGG   Edwardsiella piscicida C07-087: ETAC_00950Help
Entry
ETAC_00950        CDS       T02509                                 

Definition
(GenBank) citrate lyase subunit gamma
  KO
K01646  citrate lyase subunit gamma (acyl carrier protein)
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP DUF4242
Motif
Other DBs
NCBI-ProteinID: AGH72323
Position
complement(232920..233219)
Genome map
AA seq 99 aa AA seqDB search
MKINHAAVAGTLESSDVMVRIAPIEDDQALDLQISSSVEKQFGDAIRATVLDVLNRYQVR
GVQLIVDDKGALDCVLRARLETLLARAADLVSLPWEDRA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaccacgcagccgtcgccggcaccctagagtcgagcgacgtgatggtgcgc
atcgcgcccattgaagacgaccaggctctcgatctgcaaattagcagcagcgtcgaaaaa
cagtttggcgacgccatccgcgccaccgtgctggacgtcctcaaccgctaccaggttcgc
ggcgtacagctgatcgttgacgataaaggcgcgctcgactgtgtcctgcgcgcacgtctg
gaaaccctgctggcgcgcgccgccgatctggtcagcctgccttgggaggatcgcgcatga

DBGET integrated database retrieval system