KEGG   Edwardsiella piscicida C07-087: ETAC_00955Help
Entry
ETAC_00955        CDS       T02509                                 

Definition
(GenBank) [citrate [pro-3S]-lyase] ligase
  KO
K01910  [citrate (pro-3S)-lyase] ligase [EC:6.2.1.22]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_00955
Enzymes [BR:etc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.22  [citrate (pro-3S)-lyase] ligase
     ETAC_00955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_ly_lig Acetyltransf_1 HIGH_NTase1 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-ProteinID: AGH72324
Position
complement(233216..234292)
Genome map
AA seq 358 aa AA seqDB search
MFSNTVFTQIKRSEQKRIADITHFLRENGLNIDTSVEIFICAQRDNKIIACGGIAGDIIK
CVAISATARGEGLALTLATELVNLAYELGRNNLFIYTKEENEDMFHQCGFSTITRVPGIM
VLMENSKVRLQRYAETLATLRHPGKKIGAIVMNANPFTNGHRYLVRQAASQCDWLHLFLV
REDTSRFPYEDRLALVRSGVSDIANITLHPGSEYIISRATFPCYFIKEQGVADNCYTEID
IKIFRQYLAPALGITHRFVGTEPFCPVTAKYNQDMRYWLETPALPSPPIHLVEVARLTYH
NTPISASWVRKLLVRKDLPAITPLVPDATRAYLARLIASMPAGAERRPQESVLVTGDK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcaatactgttttcacccagattaagcgctctgagcaaaaaaggattgccgac
atcactcattttctgcgtgaaaatggcctcaacattgatacatcagtagaaatatttatt
tgcgcacagcgggataacaaaatcatcgcctgcggcggtatcgccggcgatatcataaag
tgtgtcgccatcagcgccaccgcccgcggcgaaggattagccctgacgctggccaccgaa
ttggtcaacctggcctatgaattaggacggaataatcttttcatctatacaaaagaagaa
aacgaagatatgttccaccagtgcggtttctctaccattacccgggttcccgggattatg
gttctgatggaaaacagtaaagtacgtcttcaacgctatgccgaaacattagcgacgctg
cgccacccagggaaaaaaatcggtgccatcgtgatgaacgctaacccgttcaccaacgga
caccgttacctcgtccgacaggccgccagccaatgcgactggctacacctgtttttagtc
cgtgaggatacctcacgctttccttatgaagatcggctggcgctggtgcgctccggcgtt
agtgatatcgccaatatcacgctgcacccgggctctgaatacatcatctcccgcgccacc
ttcccctgttatttcattaaagagcagggggtagccgacaactgctacaccgaaatcgat
atcaagatattccggcagtatctggcgccggcactgggcattacccaccgcttcgtcggg
acggagcccttctgcccggtcaccgccaaatacaatcaggatatgcgttactggctggaa
accccggcgctgccctctccgccgatccatctggttgaagtggccaggctgacctatcac
aacacccccatttcagcctcttgggtacgcaagctgctggtacgcaaagatcttccggca
atcaccccactggtacccgacgcgacgcgggcctatctggcccggctgatcgcatcgatg
ccggcgggtgcggagcgccggccccaggaatccgtcttagttacaggtgacaaatga

DBGET integrated database retrieval system