KEGG   Edwardsiella piscicida C07-087: ETAC_00965Help
Entry
ETAC_00965        CDS       T02509                                 

Definition
(GenBank) Transcriptional regulatory protein CitB, DpiA
  KO
K07702  two-component system, CitB family, response regulator CitB
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00486  CitA-CitB (citrate fermentation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_00965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_00965
Two-component system [BR:etc02022]
 CitB family
  CitA-CitB [MD:M00486]
   ETAC_00965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg CitT
Motif
Other DBs
NCBI-ProteinID: AGH72326
Position
236316..237002
Genome map
AA seq 228 aa AA seqDB search
MNKINILIVEDETPLAEMHAEFIRNHPCCGQLWLAGNLAQARAMIKSFHPDLVLLDNYLP
DGVGVHLLHELTQQRYPGGVVLTTAASDMDTVSEAVRSGAFDYLIKPIAYERLGQTLERY
QQRNSMLSGHQNASQRQIDSMYNAYARGDSKEDLPVGIDALTLEKVQGLFVDDTVRHTAE
SVAQSLMLSRTTARRYLEFCAARQQIVAEIVYGKVGRPQRIYRAQGKS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcaatatattaatcgtcgaggatgaaacgccgctggctgagatgcacgcg
gagtttatccgcaatcatccctgctgcggccagctgtggctggccggcaatctggctcag
gcccgggcgatgattaaaagttttcacccggatttggtgctgttggataactatttaccg
gatggcgtcggggtgcatctgctgcatgagctgacccagcagcgctatccgggcggggtg
gtgctgaccaccgccgccagcgacatggacaccgtctccgaggcggtacgcagcggcgcc
ttcgactacctgatcaaacccatcgcctacgagcgcctggggcagacgctggagcgctat
cagcagcgcaacagcatgctcagcgggcatcagaatgctagccagcgtcagatagacagc
atgtataacgcctatgcgcgcggcgacagcaaagaggatctgccggtcggcatcgatgcc
ctgacgctggagaaggtgcaggggttgtttgtggacgatacggtacgccataccgccgaa
agcgtggcgcagagcctgatgctgagccgtacgacggcgcggcgctacctggagttctgt
gcggcgcgtcagcagattgtggcggaaatcgtctatggcaaggtgggccgtccgcagcgt
atttaccgagcgcaggggaaaagctga

DBGET integrated database retrieval system