KEGG   Edwardsiella piscicida C07-087: ETAC_01040Help
Entry
ETAC_01040        CDS       T02509                                 

Definition
(GenBank) respiratory nitrate reductase subunit gamma
  KO
K00374  nitrate reductase gamma subunit [EC:1.7.5.1 1.7.99.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00910  Nitrogen metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ETAC_01040
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01040
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     ETAC_01040
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     ETAC_01040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitrate_red_gam ResB
Motif
Other DBs
NCBI-ProteinID: AGH72341
Position
complement(251575..252255)
Genome map
AA seq 226 aa AA seqDB search
MSALSYFLFNIYPYIAITVLLLGCLYRFDYGQYTWKSGSSLLMANGRYSRYALNLFHVGM
LGVFFGHVAGLLTPRSWYDAYISSQTHQILELIAGSFFGTLLLIGALMLLARRLFCARVA
ATSSFSDKLILILLTIQICLGMLTIPVDLLHPSGATLQNLISWSQGIVTFRPDPAQYLQE
VNWLFKVHMVLGLTIFLIFPFTRLVHICSLPLGYLLRRRQVVKTLR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcactgtcctattttttattcaacatctacccctatatcgccatcacggtgctg
ttgctggggtgcctctatcggttcgactatggccaatacacgtggaaaagcggctcttcg
ctgctgatggccaacgggcgctatagccgctatgcgcttaacctgtttcacgtcggcatg
ctgggggttttcttcggccacgtggccggactgctgacgccacgctcttggtatgatgcc
tatatctccagccagacgcatcagatcctggagctgatcgccggcagcttcttcggcacc
ctgctactgatcggcgcgctgatgctcttggcccgccgcctcttctgcgcccgggtcgcc
gccacctcgtcgttttccgacaagctgatcctgatcctgctgacgatccagatctgcctg
ggcatgctgacgatcccggtcgatctgctgcacccctccggcgccacgctgcaaaacctg
atcagctggagccaggggatcgtgaccttccgtcccgatccggcccagtatctgcaagag
gtcaactggctgttcaaggtgcatatggtgctggggctgaccattttcctgatcttcccc
tttactcgcctggtgcatatctgcagcctgccgctgggctatctcctgcggcgacgccag
gtcgttaaaaccctgcgctaa

DBGET integrated database retrieval system