KEGG   Edwardsiella piscicida C07-087: ETAC_01045Help
Entry
ETAC_01045        CDS       T02509                                 

Definition
(GenBank) respiratory nitrate reductase subunit delta
  KO
K00373  nitrate reductase molybdenum cofactor assembly chaperone NarJ/NarW
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitrate_red_del
Motif
Other DBs
NCBI-ProteinID: AGH72342
Position
complement(252266..252922)
Genome map
AA seq 218 aa AA seqDB search
MLSLLMLARLLDYPDEALWQARGELEAALPQCREMTAAQQKRLQAFIAHYWEAPLASRQS
DYIAQFDHTRRCALYLCEHQLAESKNRGQAMVNILSHYRQAALEPAPRELPDYLPMVLEF
AYLRSQQQPEEGRRILTQIAEVAEILYRRTHDGMYGVLFQLLLQLAGRETDGLVPEADGT
PTAAIDAEWDRAHAPARVELPDIPQGRPAPVHYLDLER
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcctgttaatgttggcccgcctgctggactaccccgatgaggcgctgtggcag
gcgcgcggtgagctggaggccgcgctgccgcagtgtcgcgaaatgacggcggcgcagcag
aagcgcctgcaggcgtttatcgcccattactgggaggccccgctggcaagccgtcaaagc
gattacattgcgcagttcgatcatacccgccgctgcgccctgtatctgtgtgagcaccag
ctggccgagtctaaaaaccgcgggcaggcgatggttaatatcctgagccactatcgccag
gccgcgctggagcccgcgccgcgggagctgcccgactatctgccgatggtgctggagttt
gcctatctgcggtcacagcagcagcctgaggagggccggcgtatcctgacgcagattgcc
gaggtggcggagattctgtatcgccgcacccacgacggtatgtacggcgtgctgtttcag
ctgctactgcagctggccggcagagagaccgatggcctggtgccagaggccgacggcacg
ccgacggcggcgatcgatgcggagtgggatcgcgcacacgctccggcccgcgttgagctc
cccgatataccccagggtcgcccggcgccggttcactacctggatcttgagcgataa

DBGET integrated database retrieval system