KEGG   Edwardsiella piscicida C07-087: ETAC_01050Help
Entry
ETAC_01050        CDS       T02509                                 

Definition
(GenBank) respiratory nitrate reductase subunit beta
  KO
K00371  nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00910  Nitrogen metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ETAC_01050
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01050
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     ETAC_01050
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     ETAC_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Nitr_red_bet_C Fer4_10 Fer4_7 Fer4_2 Fer4_6 Fer4_9 Fer4 Fer4_21 Fer4_13 Fer4_17 Fer4_4 Fer4_8 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AGH72343
Position
complement(252926..254446)
Genome map
AA seq 506 aa AA seqDB search
MKIRAQVSMVLNLDKCIGCHTCSVVCKNVWTSREGIEYGWFNNVETKPGRGFPRDWEDQD
KWHGGWQRVNGQLTPRMGGKLSLLAKIFANPHMPAVGDYYEPYSFDYAHLHNAPAGARHQ
PTARPYSLLTGKTLEKIEGSANWEDDLGGEARVRQGDRNLDGLDKQLYAQFEQTFMMYLP
RLCEHCLNPACVASCPSGAIYKRAEDGVVLINQDQCRGWRMCVSACPYKKIYYNWKSGKS
EKCIFCYPRIEAGLPTLCSESCVGRIRYIGVMLYDAEAIPAAAAEEDPQALYDAQMKIFL
DPNDPDILAQARRDGISDEILAHAQRSPVYRLIKEWRLALPLHPEFRTLPMVWYVPPLSP
IRFDDASLAEPHDIRLAELAQMRIPIDYLANLLCAGNRKPVEVALTRLIALRHYRRSLLS
PQAPQWLQQADLSAPQAEAMYRLLALAPYHERFVIPTGMHRPGSDREYIEHGSCGFSFNT
PHDTDGTNLTGYRPDDRLVINTHSKE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgtgcacaggtttccatggtgctaaacctcgataagtgcatcggttgccac
acctgctcggtggtgtgcaaaaacgtctggaccagccgcgagggcattgagtacggctgg
ttcaacaacgttgagaccaagccggggcgcggctttccccgcgactgggaggatcaggat
aagtggcacggcggctggcagcgagtcaacggccagctgacgccgcgcatgggcggcaag
ctcagcctgctggccaaaatcttcgccaatccgcatatgccggcggtaggggactactat
gaaccctactccttcgactatgcgcatttgcacaacgcccccgccggcgcacgccaccag
ccgacggcgcgcccctattcgctgctcaccggtaagacgctggagaaaattgagggcagc
gccaactgggaggatgacctgggcggcgaagcccgcgtccgtcagggcgaccgcaatctt
gatgggctggacaagcagctgtatgcccagtttgagcagaccttcatgatgtacctacca
cggctgtgcgagcactgccttaacccggcctgcgtcgcctcttgccccagcggcgccatc
tataaacgggccgaagacggcgtggtgctgatcaatcaggatcagtgccgcggctggcgc
atgtgcgtcagcgcctgcccctacaagaagatctactacaactggaaaagcgggaaatcg
gagaagtgtatcttctgctacccgcgtatcgaggccggactgccaaccctgtgctccgag
agctgcgtcggacgtatccgctatatcggcgtcatgctgtacgatgccgaggcgatcccc
gccgcagcagcagaagaggatccgcaggcgctgtacgacgcgcagatgaagatcttcctc
gatcccaacgatccggacatcctggcacaggcccgccgcgacggcatcagcgatgagatc
ctggcgcatgcccagcgttcgccggtctaccgcctgattaaagagtggcgcctagcgctg
ccgctgcatccggagttccgtacgctgccgatggtgtggtacgtgccgcccctgtcgccg
atccgcttcgatgacgccagcctggccgagccccacgatatccgcctggcggagctcgcg
cagatgcgtattccgatcgactacctggccaacctgctgtgcgccggtaaccgtaagccg
gtagaggtggcgttgacccgcctgatcgccctgcgtcactaccgccgcagcctgctcagt
ccacaggcgccgcagtggctgcagcaggccgatctcagcgctccacaggccgaggccatg
taccgccttctggcgctggcgccgtaccatgaacgcttcgtgatccccaccgggatgcat
cgcccgggaagcgatcgcgaatatattgagcacggtagctgcggcttcagcttcaatacg
ccccacgataccgacggtaccaacctcaccggctatcgccccgacgatcgcctggtgatc
aacacccatagcaaggagtaa

DBGET integrated database retrieval system