KEGG   Edwardsiella piscicida C07-087: ETAC_01055Help
Entry
ETAC_01055        CDS       T02509                                 

Definition
(GenBank) respiratory nitrate reductase subunit alpha
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00910  Nitrogen metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ETAC_01055
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01055
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     ETAC_01055
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     ETAC_01055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Nitr_red_alph_N Molybdop_Fe4S4 PUA_3
Motif
Other DBs
NCBI-ProteinID: AGH72344
Position
complement(254473..258144)
Genome map
AA seq 1223 aa AA seqDB search
MSTFLKKIRYFTAGKPMAANAHELYLQDSSDWEQSYRSRWQYDKVVRSTHGVNCTGSCSW
KIYVKSGLITWETQYTDYPETPIDLPNHEPRGCPRGASYSWYIYSANRIKYPLMRRALLD
LWREQRAQHPDAVDAWQAILDNPELSQRYKRERGMGGLVRVSWQEANELIAASNVATVKR
FGPDRVAGFSPIPAHAMLSFASGSRYLSLIGGTCLSFYDWYCDLPPSSPQTWGEQTDVPE
SADWYNAQYLVMWGSNVPQTRTPDAHFMTEARYNGTKVVAVSADYAENCKFADEWLAPRA
GTDAALALALGQVILQQFYLQQPCDYFIRYAKRFTDFPMLVMLTPCAGQENTYQSGRYLR
AADLATWQDQPLAQWKTLAFDQDSQQIVIPRGSAGFRWDQGGQWNTVQQDALSGAAIDPL
LSLQTLGEDEVCVVQPDFSHDNANDRYTLGQVPVHWITTTRGERVAVATVFDLMLAHYGL
RPRAGEIPAEDAPCSPAWAEAITGVPRQQIIRLAQEFATNARITHGRSLIIVGAGINHWF
HSDMTYRSIINVLMMCGTIGVNGGGWAHYVGQEKLRPLAGWAPVALAGDWQSPARLMNGT
SFFYNHTSQWRYENVDAHTLLSPLAERDQFPHSLIDFNVIAERLGWLPSSPQLDRNPLTL
AAEAADGDVKAEVAQALKQGTLRIASEDPDAPGNYPRVLFVWRANLLGSSSKGHEYFLKH
LLGTRHGVMEQDLQQKGLPLPQQVAWRDSVEGKLDLLVTLDFRMSTTCLYSDVILPSATW
YEKEDLSSTDMHPYVHPFTRAIDPMWEARSDWEIFKGIARQFSALCAGHLGKERDVMLTP
LLHDSPAELGQACGVSDWKNDPQTFVAGKTAPAIAVVERDYPQTYFKYTHLGPALAAHGN
GGKGVHWDTRPEIDSLCARHGSETLDGVGPCANMQDATQALETILTLAPETNGQVADRAW
RDLAAKTGQQEIADLAADKKGVHYRFADIQRQPGRVIASPLWSGIDSDRHAYTAGSLNIT
HAVPWRTLTGRQQAYQDHAWMQAFGEGFACYKPPLDTQSCRSVREHTANGQPELVLNFGT
AHQKWGIHSTYTDNQIMQTLSRGGPLIWISEHDAQRGAIADNDWVELFNGNGAMVARAVV
SQRIPAGLALMYHAQERTLNMPLSEVTGERGGIHNSITRICPNPIHMIGGYAHLSWGYNY
YGTIGSNRDETVIIRRLNRVEWD
NT seq 3672 nt NT seq  +upstreamnt  +downstreamnt
atgagtacctttctgaaaaagatccgctacttcaccgcaggcaagcccatggccgccaat
gcccatgagctctacctgcaggacagctccgactgggagcagagctaccgcagccgctgg
cagtacgataaggtggtgcgatccacccatggggtgaactgtaccggctcctgcagctgg
aaaatctacgtgaaaagcgggctgattacctgggagacgcagtataccgactacccggaa
acgcccatcgatctgcctaatcacgagccgcgcggctgcccgcgcggcgccagctactcc
tggtatatctatagcgccaaccggattaaatacccgctgatgcgcagggcgctgctggat
ctgtggcgtgagcaaagagcgcagcaccccgacgccgttgacgcctggcaggccattctg
gacaaccccgagctgagccagcgctataagcgcgagcgcggtatgggcggcctagtccgc
gtctcctggcaagaggccaacgagctgatcgcggcgtccaatgtcgccaccgtcaaacgc
tttggccccgatcgcgtcgccggattttcgccgatcccggctcacgctatgctctcgttc
gcctccggctcccgctacctgtcgctgatcggcggcacctgcctgagcttctacgactgg
tattgcgatctgccgccctcctcgccgcaaacctggggcgaacagaccgacgtgccggag
tccgccgactggtataacgcacagtatttagtgatgtggggatctaacgtgccgcaaacc
cgcacgccggacgcccactttatgaccgaggcacgctacaacggcaccaaggtagtggcc
gtcagcgccgactatgcggaaaactgcaagttcgccgatgagtggctcgcgccgcgggcc
ggcaccgatgccgcgctagcgctggcattaggccaggttattctgcagcagttttaccta
cagcagccctgcgactactttatccgctatgccaaacgctttaccgacttcccaatgctg
gtgatgctgacgccctgcgccggccaagaaaacacctatcaatcaggacgctacctgcgc
gccgccgatctggcgacgtggcaagaccagccgctggcccagtggaaaaccctggcattc
gaccaagattcacagcagatagtcattccccgcggctcggcgggatttcgctgggatcag
gggggacagtggaacaccgtacagcaggatgccctcagcggcgccgccatcgatccgctg
cttagcctgcagacgctgggagaagacgaggtctgcgtcgttcagcctgacttcagccat
gacaacgccaacgaccgctataccctcggtcaggtgccggtgcactggatcaccacgacc
cgcggcgagcgcgtcgccgtcgccaccgtcttcgatctgatgctggctcactacggcctg
cgcccgcgcgcgggagagatccccgcggaagatgcgccctgctctccggcctgggccgag
gccattaccggcgtaccgcgccagcagatcatccgtctggcgcaggagtttgctaccaac
gcccgcataacccatggccgctcgctgatcatcgtcggagccgggatcaaccactggttc
catagtgatatgacctatcgcagcatcatcaacgtgctgatgatgtgcggcaccatcggc
gtcaacggcggcggctgggcgcactatgtcggtcaggaaaagctgcggccgctggccgga
tgggcgccggtcgccctggcgggagactggcaaagcccggcgcgcctgatgaacggcacc
tcgttcttctacaatcacaccagccagtggcgctatgaaaacgtggatgcccatacgctg
ctgtcgccgctggccgagcgtgaccagttcccccatagcctgatcgacttcaacgtcatc
gccgaacgcctgggctggctgccctcttctccccagctggatcgcaacccgctcacgctg
gccgccgaggcggcggacggcgacgtcaaggccgaggtcgcgcaggcgctgaaacagggc
accctacgcatcgccagcgaagatcccgacgcgccgggaaactatccgcgcgtactgttt
gtctggcgcgccaacctgctcggctcctccagtaaagggcatgaatactttctgaaacac
ctgctgggcacccgccacggcgtcatggagcaggatctgcagcaaaaagggctgccgctg
ccgcagcaggtcgcctggcgcgacagcgtcgagggcaagcttgacctgctggtgacgctc
gacttccgaatgtccacgacctgtctctattcagacgtgatcctgccgtcggccacctgg
tatgagaaagaggacctcagcagtaccgacatgcacccctatgttcacccctttacccgc
gccatcgatcccatgtgggaggcgcgctcggactgggagattttcaaagggatcgcccgg
cagttctccgctctgtgcgcggggcacctgggcaaagagcgcgatgtcatgctcacgccg
ctgctgcatgactcaccggcagagctgggccaggcctgcggcgtcagcgactggaaaaac
gatccgcagacctttgtcgccgggaaaaccgcgcccgccatcgccgtcgtggagcgcgac
tatccgcagacctattttaaatatacccacctcggcccggcgctggcggcccacggcaac
ggcggcaagggcgttcactgggacacccgccccgagatcgacagcctatgcgcgcgtcac
ggcagcgagacgctggacggcgtcggcccctgtgccaacatgcaggatgccacccaggcg
ctggagaccattctcaccctggcgccggaaaccaacggccaggttgccgatcgcgcctgg
cgcgatctggccgccaaaaccggtcagcaagagatagccgacctggccgccgacaagaaa
ggcgtgcactaccgtttcgccgatattcagcgccagccgggacgggtgatcgccagcccg
ctgtggtcgggcattgacagcgatcggcacgcctacaccgccggcagcctgaacatcact
cacgccgtcccctggcgcaccctgaccggccgtcagcaggcctatcaggatcacgcctgg
atgcaggccttcggcgaaggcttcgcctgctataaacccccgctggatacccaaagctgc
cgcagcgtacgcgaacatacggccaacgggcagccggagctggtgctgaactttggcacc
gcccaccagaaatgggggatccactccacctataccgacaaccagatcatgcagaccctg
tcgcgcggcggcccgctcatctggatcagcgagcacgatgcgcagcgcggcgccatcgcc
gacaacgactgggtcgagctgtttaacggcaacggcgccatggtggcgcgcgcggtggtc
agccagcgcattcccgccgggctggcgctgatgtaccacgcccaggagcgtacgttgaac
atgcccctgtcggaggtcaccggggagcgcggtgggatccacaactccattacccggatt
tgtcccaacccgatccacatgatcggcggctatgcccacctgtcatggggctacaactat
tacggcaccatcggctccaaccgggatgaaactgtgattattcgcaggcttaaccgggtg
gagtgggactga

DBGET integrated database retrieval system