KEGG   Edwardsiella piscicida C07-087: ETAC_01085Help
Entry
ETAC_01085        CDS       T02509                                 

Definition
(GenBank) ornithine decarboxylase
  KO
K01581  ornithine decarboxylase [EC:4.1.1.17]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00330  Arginine and proline metabolism
etc00480  Glutathione metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ETAC_01085
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ETAC_01085
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     ETAC_01085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OKR_DC_1 OKR_DC_1_N Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGH72350
Position
266917..268218
Genome map
AA seq 433 aa AA seqDB search
MNSLKIAVSLNVIAYFNTSRTTVDINDSDLTDVAAVVLSVQDALGGALDKVEQSAFGLPV
FVAEACDQRLPAEYLPRLTGVFACGDGNQDFYGKQLESAAQKYEAELLPPFFGSLQAYVQ
QGNAAFDCPGHQGGQFFRRHPTGRQFFDYFGEALFRADLCNADVSMGDLLIHEGAPCAAQ
QHAAKVFNADKTYFVLNGTSSSNKVVLNALLAPGDLVLFDRNNHKSNHHGALIQAGATPV
YLETARNPFGFIGGIDAHCFEEKYLRDLVRDIAPARAGERRPFRLAVIQLGTYDGTIYNA
RQVVDKIGHLCDYILFDSAWVGYEQFIPMMKECSPLLLELNENDPGILVTQSVHKQQAGF
SQTSQIHKKDRHIKGQARYVNHKRLNNAFMMHASTSPFYPLFAALDVNARMHAGDSGKRM
WIGVRSGVGIENP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcttaaaaattgcagtaagtctaaatgtcattgcgtattttaatacctcacgt
acaacggtagatattaatgatagcgatcttaccgacgttgccgccgtggtgctgtcggta
caggatgcgctgggcggtgcgctggataaggtcgagcagagcgcctttggcctgcccgtc
tttgtcgccgaggcgtgcgatcagcgcctgccggccgagtatctgccgcgcctgaccggc
gtatttgcctgcggcgatggcaatcaggatttttatggcaagcagctggaaagcgcggcg
cagaaatatgaggccgagctgctgccgccgtttttcggcagcctacaggcctatgtccag
cagggcaacgccgcctttgactgcccggggcatcagggcggtcagttcttccgccgccac
cccaccggccgccagttcttcgactactttggcgaggccctgttccgcgccgatctgtgc
aacgccgacgtctccatgggcgatctgctgatccacgaaggcgccccctgtgccgcccag
cagcacgcggccaaggtgttcaacgccgacaagacctactttgtgctcaacggcacctcc
tcctccaataaagtggtgctcaacgcactgctggcgcccggtgatctggtcctcttcgac
cgtaataatcataaatctaaccaccacggcgcattgattcaggccggcgctacgccggtc
tacctggagaccgcgcgtaacccgttcggtttcatcgggggcatcgacgcacactgcttt
gaggaaaaatacctgcgtgacctggtgcgtgacatcgccccggcgcgcgccggggagcgg
cggccgttccgcctggcggttatccagctgggcacctatgacggcaccatctacaacgcc
cgtcaggtggtggacaagataggtcacctgtgcgactacatcctgttcgactccgcctgg
gtcggctatgagcagttcatcccgatgatgaaagagtgctcgccgctgctgctggagctg
aacgagaacgatccggggatcctggtgacccagtcggtgcacaaacagcaggccggcttc
tcccagacctcgcagatccacaaaaaggaccggcatatcaaggggcaggcgcgctatgtc
aaccataagcgcctgaacaacgcctttatgatgcacgcctccaccagcccgttctacccg
ctgttcgccgccctggacgtcaacgcccgcatgcacgccggcgacagcggcaagcgcatg
tggattggagtgcgttccggggtgggcattgaaaacccgtaa

KEGG   Edwardsiella piscicida C07-087: ETAC_01090Help
Entry
ETAC_01090        CDS       T02509                                 

Definition
(GenBank) ornithine decarboxylase
  KO
K01581  ornithine decarboxylase [EC:4.1.1.17]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00330  Arginine and proline metabolism
etc00480  Glutathione metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ETAC_01090
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ETAC_01090
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     ETAC_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OKR_DC_1_C OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AGH72351
Position
268478..269098
Genome map
AA seq 206 aa AA seqDB search
MPATILANFLRENGIVPEKCDLNSILFLLTPAEDMAKMQHLVAQIARFERLLEQDAPLAE
VLPSIYRANEARYRGYTLRQLCQEMHDLYVSHDVKQLQKEMFRKAHFPRVVMNPQQANIE
FVRGNVELVSLARAEGRIAAEGALPYPPGVLCVVPGEIWGGSVQRYFLALEEGINRLPGF
APELQGVYIQQDEDGRKRAYGYVIKQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcgaccattctggccaacttcctgcgcgaaaacggcatcgtgccggagaaatgc
gacctgaactcgatcctgttcctgctgaccccggcggaggacatggccaagatgcagcac
ctggtggcccagatcgcccgcttcgagcgcctgctggagcaggacgccccgctggccgag
gtgctgccgtccatctaccgcgccaacgaggcgcgctaccgcggctacaccctgcgccag
ctgtgtcaggagatgcacgacctgtacgtcagccacgatgtgaagcagctgcagaaggag
atgttccgcaaggcgcacttcccgcgggtggtgatgaacccgcagcaggccaacattgag
ttcgtgcgcggcaacgtcgagctggtctccctggcgcgggccgaagggcgcatcgcggcg
gagggggcgctgccgtacccgccgggggtgctgtgcgtggtgccgggagagatctggggt
ggctcggtgcagcgctacttcctggcgctggaagagggcatcaaccggctgccgggcttt
gcgccggagctgcagggggtctacatccagcaggatgaggatggccgcaagcgcgcctat
ggctatgtgatcaagcagtaa

DBGET integrated database retrieval system