KEGG   Edwardsiella piscicida C07-087: ETAC_01130Help
Entry
ETAC_01130        CDS       T02509                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc00250  Alanine, aspartate and glutamate metabolism
etc00471  D-Glutamine and D-glutamate metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_01130
   00220 Arginine biosynthesis
    ETAC_01130
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ETAC_01130
Enzymes [BR:etc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ETAC_01130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase CCD
Motif
Other DBs
NCBI-ProteinID: AGH72359
Position
275108..276034
Genome map
AA seq 308 aa AA seqDB search
MQTELSDQLLDEILDQVRPLLGQGRVANYIPALAEVAPDRLGIAVCTVDGRMFSAGDAGE
RFSIQSISKVLSLTLAMHRYSEAEIWQRVGKEPSGQPFNSLVQLELEQGKPRNPFINAGA
LVVCDMLQSRLSAPRQRMLEVVRALSGSADICYDARVARSEFEHSDRNAAIAYLMKSFGN
FDNDVITVLHNYFHYCALRMNCMELARTFVYLANRGRALALDEPVIGERQARQINALMVT
SGLYDGAGEFAYRVGMPGKSGVGGGVVAVVPQEMIIAVWSPQLDSCGNSLAGIAALELLA
QRIGRSIF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactgaattaagcgatcaactgttagacgagatcttggatcaggttcgtccgctg
ctcgggcaggggcgggtcgccaactatattccggcgctggccgaggttgcgccggacagg
ctgggtatcgcggtctgcaccgtcgacggacggatgttcagcgccggcgacgccggcgaa
cgcttctccatccagtcgatctccaaggtgctaagcctgacgctggcgatgcatcgctac
agcgaggccgagatctggcagcgggtcggcaaggagccctcgggacagccgtttaactcg
ctggtgcagctggagctggagcagggcaagccgcgtaacccctttattaacgccggcgcg
ctggtggtgtgcgatatgctgcagtcgcgtctgagcgcgccgcgtcagcgcatgctggag
gtggtgcgggcgctgagcggcagcgcggacatttgctatgatgctcgggtggcgcgctcc
gagtttgagcattcggatcgcaatgcggcgatcgcctatctgatgaagtcgtttggcaac
ttcgataacgacgtgattaccgtcctgcataactatttccactattgcgctttaagaatg
aactgtatggaactggcgcgcacttttgtttatcttgccaatcgggggcgcgcgttggcg
ctggatgagccggtgatcggcgagcgtcaggcgcgccagatcaatgcgctgatggtgacc
agcggcctgtatgacggcgcgggcgagttcgcctatcgcgtcgggatgccggggaagtcc
ggcgtcggcggcggcgtggtggccgtggtgcctcaggagatgatcatcgccgtttggagt
ccgcagctggatagctgcggtaattcactggccggaattgcggcgctggagctgttggct
cagcgcattggccgctcaatattttaa

KEGG   Edwardsiella piscicida C07-087: ETAC_13800Help
Entry
ETAC_13800        CDS       T02509                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc00250  Alanine, aspartate and glutamate metabolism
etc00471  D-Glutamine and D-glutamate metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_13800
   00220 Arginine biosynthesis
    ETAC_13800
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ETAC_13800
Enzymes [BR:etc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ETAC_13800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AGH74881
Position
complement(3108300..3109235)
Genome map
AA seq 311 aa AA seqDB search
MTLDAQRLQQAVDAAHAQYATLAGGKNADYIPYLASVPSQLAAVAVVTRDGAVYCAGDSD
YRFALESISKVCTLALALEDVGPEAVQEKIGADPTGLPFNSVMALELHGGKPLSPLVNAG
AMASASLIKADNREQRWQRILAIQQQLAGETVALSDEVNQSEQTTNFHNRAIAWLLYSAG
TMYCDPMEACDVYTRQCSTLIDTVELATLGATLAAGGVNPRSGRRVLQADNVPYILAEMT
MEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEAGNSVRGQKMVADV
AARLGYNLYKA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacgttagatgcacagagattgcagcaggccgtcgatgcggcccatgcacagtatgcg
acgctggccgggggaaaaaacgcggactacatcccctatctggccagcgtgccgagccag
ctggcggcggtggcggtggtcacgcgcgacggcgcggtgtactgcgccggcgacagcgac
taccgtttcgccctggagtcgatctccaaggtgtgtaccctggcgctggcgctggaggac
gtggggcccgaggcggtgcaggaaaagatcggcgccgacccgactggtctgccgttcaac
tcggtgatggcgctggagctacacggtggcaagccgctgtcaccgctggtcaatgcgggg
gccatggcctcggctagcctgattaaggccgacaaccgtgagcagcgctggcagcgtatt
ttggccattcagcagcagctggccggcgagacggtggcgctgtcggacgaggtgaaccag
tcggagcagaccaccaactttcacaaccgcgccatcgcctggctactctattcggccggc
accatgtactgcgatccgatggaggcctgcgacgtgtatacccgtcagtgctccacgctc
attgataccgttgagctggcgacgctgggcgccacgctggcggcgggcggggtcaatccg
cgcagcgggcggcgggtgctgcaggccgacaacgtgccctacattctggcggaaatgacc
atggaggggctgtacggacgatccggcgactgggcctaccgcgtcggtctgccgggcaag
agcggggtcggcggtgggatcctggccgtggtgccgggggtgatgggcatcgcggccttt
tctccgccgctggatgaggcgggtaacagcgtccgcgggcaaaaaatggtggcggacgtc
gccgcacggctgggctataacctgtataaggcctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_16790Help
Entry
ETAC_16790        CDS       T02509                                 

Gene name
glnA
Definition
(GenBank) glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc00250  Alanine, aspartate and glutamate metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc00910  Nitrogen metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01230  Biosynthesis of amino acids
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_16790 (glnA)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ETAC_16790 (glnA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_16790 (glnA)
   00220 Arginine biosynthesis
    ETAC_16790 (glnA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_16790 (glnA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_16790 (glnA)
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     ETAC_16790 (glnA)
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAC_16790 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N
Motif
Other DBs
NCBI-ProteinID: AGH75479
Position
3785847..3787256
Genome map
AA seq 469 aa AA seqDB search
MSAEHILAMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVDADFFEEGKMFDGSSIGGWKG
INESDMVLMPDPTTAVLDPFYEEPTLIIRCDILEPGTLQGYDRDPRSISKRAEDFLRASG
IADTVLFGPEPEFFLFDDIRFGSSINGSHVAIDDIEGAWNSSTKYEGGNKGHRPAVKGGY
FPVPPVDSAQDIRSTMCLTMEEMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYK
YVVHNVAHAFGKTATFMPKPMFGDNGSGMHCHMSLSKNGSNLFAGDKYGGLSETALYYIG
GVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVR
FPDPAANPYLCFAALLMAGLDGVINKIHPGDAMDKNLYDLPPEEAKEIPTVAGSLDEALA
ALDSDREFLTRGGVFTDDAIDAYIELRQSEMERVRMTPHPVEFELYYSV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgaacatatcttagcgatgctgaatgagcacgaagttaaatttgtcgatctg
cgctttaccgataccaagggtaaagagcagcacgtcaccattccggctcatcaggttgac
gccgacttcttcgaagaaggcaagatgtttgacggctcctccatcggcggctggaaaggc
atcaatgagtcagacatggtgctgatgccggatcccaccaccgcggtactcgacccgttc
tatgaagagccaacgctgatcattcgctgcgatattctggaaccgggcaccctgcagggc
tacgaccgcgacccgcgctccatctccaagcgcgccgaagacttcttgcgcgcctccggc
atcgccgacaccgtactgttcgggccggagccagagttcttcctgttcgacgatatccgc
ttcggcagcagcatcaacggcagccacgttgccattgacgacatcgaaggcgcatggaac
tcctcaaccaaatacgagggcggtaacaaagggcaccgtccggcggttaaaggcggctac
ttcccggttccgccggttgattcggctcaggatatccgctcgaccatgtgcctgaccatg
gaagaaatgggactggtggtagaagctcaccaccatgaggtggccaccgccgggcagaat
gaagtcgccacccgcttcaacaccatgaccaagaaagcggacgaaatccagatctacaaa
tatgtggtgcacaacgtcgcccacgccttcggtaaaaccgccacctttatgcccaagccg
atgttcggtgacaacggctccggcatgcactgccatatgtctctgtctaaaaacggcagc
aacctgtttgccggcgacaagtacggcggcctgtctgaaaccgcgctgtactatatcggc
ggggtgatcaagcacgccaaggccatcaacgccctggccaacccgaccaccaactcttac
aagcgtctggtaccgggctatgaagcgccggtgatgctggcctactctgcccgcaaccgc
tccgcctccattcgtatcccggtggtggcgtcgccgaaggctcgccgcatcgaggtccgt
ttccctgacccggcggccaacccgtacctgtgcttcgccgccctgctgatggctggcctg
gatggcgtcatcaacaaaatccaccccggcgacgccatggataaaaacctgtatgacctg
ccgccggaagaggctaaagagatcccgaccgtagccggctctctggatgaggccctggcc
gcgctggacagcgatcgcgagttcctgacccgcggcggcgtctttaccgacgatgccatc
gatgcctacatcgagctgcgccagtcagaaatggagcgcgtacgcatgacgccgcacccg
gtcgagtttgaactctactacagcgtataa

DBGET integrated database retrieval system