KEGG   Edwardsiella piscicida C07-087: ETAC_01140Help
Entry
ETAC_01140        CDS       T02509                                 

Definition
(GenBank) hypothetical protein
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01501  beta-Lactam resistance
etc02010  ABC transporters
etc02024  Quorum sensing
Module
etc_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_01140
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_01140
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ETAC_01140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_01140
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    ETAC_01140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: AGH72361
Position
276866..278515
Genome map
AA seq 549 aa AA seqDB search
MSSTLVMEGNDMKIKYNLFFGFGVFMFSLGAPLAAEVPPGVSLAAAQTLTRNNGSEPASL
DPHRSESDVEFNILRDFFEGLLTLDGEGHLRPGLAARWQHSEAGRVWTFSLRPDLRWSNG
EALTAQDLVFSWRRLIDPATASPYATFLVNMGIKNAAAIQEGALPPSALGVAAPDARTLR
VTLDQPLSTFLPMMVHPTLVPLNPRVLARYGDKWTQPGHFVGNGAYTLKQWVINERLVGE
RNPHYWDDAHTVIHQVVYLPIVSETAGVNRYRAGELDMTSLPSALFASLKQSLGEQVQIF
PKLGTYYYHFNTRRAPFDDVRVRQALNLGLDKEIIAQKVLGQGQRPAWLFGSDDIGGMAL
RAPDYARWPRETRLARAKALLAEAGFGPGNPLRFTLLYNTSEGHQRIAIAAASMWKKNLG
VEATLNNQEWKSMLDTMRSGHFDVVRNAWVADYDDPAAMLNTFRSGDSNNTPQYSNPRFD
AVLAQASASQDPAARQRLFQQAEALLAEDVPTIPLYHYVSVRLVKPYVGGYQPGNMDYLY
SKDMYIRAH
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgacgctggtcatggagggtaacgatatgaaaattaaatataatttatttttt
ggattcggtgtttttatgttttcgctcggcgcaccgctcgccgccgaggtgccgccgggc
gtgtcgctggcggcagcccagacgctgacgcgcaataacggcagcgagccggcctctctc
gatccgcaccggtcggaaagcgatgtcgaattcaacatccttcgcgacttctttgagggg
ctgctgacgctcgacggcgaggggcatctgcgcccggggctggcggcgcgctggcagcat
agtgaggcggggcgggtatggaccttctcgctgcgccccgatttgcgttggtctaacggc
gaggcgctgacggcacaggatctggtctttagctggcggcggctgatcgacccggcgacc
gcctcaccctacgccaccttcctggtcaacatgggaataaagaacgccgccgcgatccaa
gagggcgcgctgccgcccagcgcgttgggcgtcgcggcgccggatgcgcgtacattacgc
gtcacgctggatcagcccctgtcgaccttcctgccgatgatggtgcatccgacattggtg
ccgctcaacccacgggtactcgcccgctacggcgacaaatggactcaaccgggccacttt
gtcggtaacggagcctatacgctgaagcagtgggtgatcaacgagcgcctggttggtgag
cgcaatccgcactactgggacgacgcgcacacggtgatccatcaggtggtctatttaccg
attgtctctgaaacggccggggtgaaccgctatcgcgcgggagagctggatatgacctcc
cttcccagtgcgctgttcgcgtcgctgaagcagtcgctgggcgagcaggttcagatcttc
cctaagctcgggacatactactatcacttcaacacccgcagggcgcccttcgacgatgtg
cgggtgcgtcaggcgcttaacctggggctggataaagagatcattgcgcagaaggtgctg
gggcaggggcaacgtccggcctggctgttcggctcggatgatatcggggggatggcgcta
cgggcgccggactacgcccgctggccgcgtgagacgcgcctcgcgcgcgcaaaggcgctg
ctggccgaggctgggtttgggcccggaaacccgctgcgttttacgctgctgtataacacc
tctgaggggcaccagcgtattgctatcgccgccgcctccatgtggaagaagaacctgggc
gtggaggcgacgctgaataaccaggagtggaagagcatgctggataccatgcgcagcggc
cacttcgacgtggtgcgtaacgcctgggtcgccgactatgacgatccggcggcgatgctg
aatacctttcgcagcggcgacagcaataataccccgcagtacagcaacccccgcttcgac
gccgtgctggcgcaggcgtcggccagtcaggatccggcggcgcgccagcggctgttccag
caggcagaggcgctgctggccgaggatgtgccgaccattccgctataccactacgtcagc
gtgcggctggtgaagccctatgtcggcgggtaccagcccggcaacatggactacctctat
agcaaggacatgtatatccgcgctcactga

KEGG   Edwardsiella piscicida C07-087: ETAC_07090Help
Entry
ETAC_07090        CDS       T02509                                 

Definition
(GenBank) oligopeptide ABC transporter substrate-binding protein OppA
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01501  beta-Lactam resistance
etc02010  ABC transporters
etc02024  Quorum sensing
Module
etc_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_07090
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_07090
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ETAC_07090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07090
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    ETAC_07090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AGH73539
Position
1615582..1617216
Genome map
AA seq 544 aa AA seqDB search
MSKHIIKKSMLTLGICSALGVAAIAQAAEVPAGVKLAAKQELVRNNGSEVSSLDPHKIEG
VPENNVTNDLLEGLTQHDSQGQTIPGVAQRWESKDNKVWVFYLRPDAKWSNGDPVTAEDF
VYSWQRMADPKTASPYASYLQYAHVANIDDIIAGKQDKSALGVKALDDRTFQVTLSEPVP
YLPEMTAHYAMKPVNKAAVEKFGDKWTLPQNYVSNGAYKLKDWIVNERIVLERNPQYWDN
AKTIIDKVTFLPIASEVTDVNRYRAGEIDMTYNNMPIELFQKLKKEIPEQVKVDPYLCTY
YYEINNQKPPFNDPRVREALKLGLDRDIIVNKVKNQGDLPAYSFTPPYTDGAALTQPAWF
GWSQEKRNQEAKLLLAEAGYGPGKPLTFNLLYNTSDLHKKLAIAAASIWKKNLGIDVKLE
NQEWKTFLDSRHQGNYDVARAGWCADYNEPSSFLNMMLSTSSNNTPHYKSPAFDRIMASA
LQAPDKAGRATVYQQAEQQLDRDSAIVPVYYYVNARLVKPFVGGYTGKDPLDYVYDKNLY
IVQH
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacacatcattaaaaaaagtatgttaacccttgggatttgcagcgcactgggc
gtcgcggcgatagcgcaggccgccgaggttccggccggtgtaaaattggcggctaagcag
gagctggtcagaaataatggttcggaggtctcctctctcgatccgcacaagatcgaaggg
gtgccggaaaacaacgtgaccaacgatctgctggaagggctgacgcagcacgatagccag
gggcagacgatcccgggcgtcgcgcagcgctgggagagcaaagataataaagtgtgggta
ttttacctgcgtccggacgcgaagtggtccaacggtgaccctgtcaccgcagaggacttc
gtctatagctggcagcggatggccgaccccaagaccgcatccccctacgcgagctatctg
cagtatgcccacgtcgcgaatatcgatgacatcatcgccggcaaacaggataaatccgcc
ctgggagtcaaggcgctggacgatcgcacgttccaggtgaccctgagcgagccggtcccc
tacctaccggagatgaccgcgcactatgcgatgaagccggtcaacaaggcggcggtagag
aaattcggcgacaagtggactctgccgcagaattatgtcagcaacggcgcctataagttg
aaggactggatcgtcaacgagcgcatcgtgctggagcgaaacccgcagtattgggacaat
gcgaagacgatcatcgataaggtgaccttcctgcccatcgcatcggaagtgaccgatgtg
aaccgctatcgggccggcgagatcgatatgacctataacaatatgccgatcgagctgttc
cagaagctgaagaaggagatccccgagcaggtgaaagtggatccctatctgtgcacctac
tattacgagatcaataaccagaagccgccgtttaacgacccccgcgtgcgcgaggcgctg
aagctggggctggatcgcgatattattgtgaataaggtcaaaaatcagggcgatctgccg
gcatacagctttacgccgccctataccgacggcgccgcgctgacgcagccggcctggttt
ggctggtcgcaggagaagcgcaaccaagaggccaagctgctgctggcggaggcgggctat
ggcccgggcaagccgctgacctttaatctgctctacaacacctccgatctgcacaagaag
ctggcgattgccgcggcttcgatctggaagaaaaacctggggatcgacgtgaagctggag
aatcaggagtggaagaccttcctcgattcgcgccatcagggcaattacgatgtcgctcgc
gccggctggtgcgccgactataacgagccgagctctttcctcaatatgatgctgtcgacc
agcagcaacaataccccgcactacaagagcccggcctttgaccgcattatggccagtgcg
ctgcaggcgccggacaaagccggccgcgcgacggtctaccagcaggctgagcagcagctg
gaccgtgattcagccatcgttcccgtgtattactacgttaacgcccgtctggtgaaaccc
tttgtcggtggctataccggcaaggatccgctggactatgtctacgacaaaaacctttat
atcgttcaacattaa

KEGG   Edwardsiella piscicida C07-087: ETAC_08495Help
Entry
ETAC_08495        CDS       T02509                                 

Definition
(GenBank) murein tripeptide ABC transporter periplasmic substrate-binding protein
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01501  beta-Lactam resistance
etc02010  ABC transporters
etc02024  Quorum sensing
Module
etc_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_08495
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_08495
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ETAC_08495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_08495
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    ETAC_08495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 PSD4 DUF4038 SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: AGH73820
Position
complement(1934282..1935898)
Genome map
AA seq 538 aa AA seqDB search
MQLFRLAAAAAIGVVASNGALAAQVPPGTVLAETQSVVRHLKDEPVSLDPVAAVGLTEAQ
VLRDLFEGLVNQGPDGSVQPGVASAWQSKDQQRYVFQLRDTARWSNGDAVTAYDFVYAWR
RLVDPQTHSPFAWFAETAGIANAAEIVSGQLPPDRLGVTAPDARTLVVQLNRPLPYFPQL
CAHFSLFPQPQKVVERYGQAWTRPGNLVGNGAFQLAQRVVNEHIVLTPNPYYWDHAQTRL
TRVTFVPINQESAATKRYLAGDLDITESFPKNMYQALKKRIPDEVFTPVQLGTYYYAFNT
RRAPLNDARVRRALSYAIDREIIAGKVVGSGEKPAYRLTPDVTDGVVPQPLPMQRMSQAE
RNRQARAWLREAGYGPSRPLRLTLLYNTAENHQKIAIAVASMWKKSLGVQVKLTNQEWKT
YVDSRNSGQFDVVRASWIADYNEASSFLGLLGSRHSGNLSGFSQPAYDALLQQAAREGNG
QTRSAIYQQAERMLAEEAPIAPLYQYTNARLIKPWVKGYPINNPEDVAYSHQLYILQH
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttttcgtctggccgccgcggcggccattggggtcgtcgccagtaacggcgcc
ctggcggcgcaggtgccgccgggcaccgttctggcggagacgcagagcgtggtacgccat
ctgaaggatgagccagtatcgctggatcccgtcgccgccgtcggattgacggaggcgcag
gtgctgcgcgatctgtttgaggggctggttaatcaggggccggacggcagcgtccagccc
ggcgtcgcctccgcctggcaaagtaaggatcagcagcgctatgtctttcagctgcgcgat
acggcgcgctggtctaacggcgatgccgtcaccgcctatgactttgtttatgcctggcga
cgtttggtcgatccgcagacccactccccctttgcctggtttgccgagacggcggggatc
gccaacgccgcggagatcgtcagcggtcagctgccccccgatcggctgggtgtaacggcc
ccggatgcccgtacgctggtggtacagttgaatcgcccgctgccctatttcccacagctg
tgcgcccatttcagcctgttcccgcagccgcagaaggtggtcgagcgctacggccaggcg
tggacgcgcccgggtaacctggtgggcaacggcgcgttccagctggcgcagcgggtggtc
aacgaacatatcgtgctgacgccgaacccctattactgggatcacgcccagacccggctg
accagggtgacctttgttccgataaaccaggagagcgcggcgaccaaacgctatctggcc
ggggatctggatattaccgagtcttttccaaaaaacatgtatcaggcgctgaagaagcgc
attcccgacgaggtgtttacgccggttcagctgggcacctactactatgcgttcaatacc
cgccgggcgccgctgaacgatgcgcgggtgcgacgcgcgctctcctatgccatcgatcgc
gagatcatcgccggcaaggtggtgggcagcggggagaagccagcctaccggctgacgccg
gatgtgaccgatggcgtggtgccgcagccgctgccgatgcagcggatgagccaggcggag
cgtaaccgtcaggcgcgggcctggctgcgcgaggcgggctacgggccatcgcgcccgctc
cggctgacgctgctgtataacacggcggagaatcaccagaaaattgccatcgccgtggca
tcgatgtggaaaaagagcctgggggttcaggtcaagctgaccaatcaggagtggaaaacc
tacgtcgatagccgtaacagcggccagtttgacgtggtgcgtgcgtcgtggattgccgac
tataacgaggcctccagctttctggggctgctggggagccgccacagcggcaatctgagc
ggctttagccagccggcatacgatgcgctgctgcagcaggccgcgcgggagggcaatggg
cagacgcgtagcgccatctaccagcaggcagagcgcatgctggcggaggaggcgccgatc
gctccgctgtaccaatacaccaatgcccgtctgattaagccctgggtaaaggggtatccc
atcaataatccagaggatgtcgcctacagccaccagctgtatatcctacagcactag

DBGET integrated database retrieval system