KEGG   Edwardsiella piscicida C07-087: ETAC_01280Help
Entry
ETAC_01280        CDS       T02509                                 

Gene name
torD
Definition
(GenBank) chaperone protein TorD
  KO
K03533  TorA specific chaperone
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_01280 (torD)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01280 (torD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:etc03110]
    ETAC_01280 (torD)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_01280 (torD)
Chaperones and folding catalysts [BR:etc03110]
 Other chaperones and cochaperones
  Others
   ETAC_01280 (torD)
Transporters [BR:etc02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   ETAC_01280 (torD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitrate_red_del
Motif
Other DBs
NCBI-ProteinID: AGH72389
Position
complement(303298..303981)
Genome map
AA seq 227 aa AA seqDB search
MSTAGPLTAQHYACLYAWLAGLFAHEADEAQLARLRSPDTQAWLDLLCQQAPLRPALQHL
QAALAALETRPDARLELAADFAGLFLLSQKRAALPYASCYQGETPRFRQAICVEMQSLLR
QAGMQLNADFHEPEDHLSIFLELLSHLSFASAEQPEHQESERMQLRRTTLSLLLGWLPAF
SARCVRYDPFGFYGALSQLLLALVQQDADLSAVERVSSAATPGPIAG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccggcccgttgacggcacagcactatgcctgcctgtacgcctggctggcc
gggctgttcgcccacgaagcggacgaggcgcagctggcccgtctgcgctcgcccgatacg
caggcctggctcgatctgctctgccagcaggcgcccctgcgcccggcgctgcagcacctg
caggcagcgctcgccgcgctggagacgcgcccggacgcccgtctggagctggcggcagac
ttcgccggtctatttttgctgtcgcagaagcgggcggcgctgccctatgcctcctgctat
cagggagagacgccgcgctttcgccaggcgatctgcgtggagatgcagtccctgctgcgc
caggccggcatgcagctgaacgccgactttcacgagccggaggatcacctgtccatcttc
ctggagctgctcagccatctgagcttcgccagcgcagagcagccggagcaccaggagagc
gaacggatgcagctacgccgtaccaccctgagcctgttgctcggctggctgccggcgttc
agcgcacgctgtgtccgctacgatccgtttggtttctacggcgccctgagccagctgctg
ctggcgctggttcagcaggatgccgacctcagcgccgtcgagcgcgtatcatcggccgcc
acaccagggcccattgccggataa

DBGET integrated database retrieval system