KEGG   Edwardsiella piscicida C07-087: ETAC_01285Help
Entry
ETAC_01285        CDS       T02509                                 

Definition
(GenBank) trimethylamine N-oxide reductase I catalytic subunit
  KO
K07811  trimethylamine-N-oxide reductase (cytochrome c) [EC:1.7.2.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_01285
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_01285
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.3  trimethylamine-N-oxide reductase
     ETAC_01285
Transporters [BR:etc02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   ETAC_01285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdopterin_N PUA_3
Motif
Other DBs
NCBI-ProteinID: AGH72390
Position
complement(303978..306527)
Genome map
AA seq 849 aa AA seqDB search
MNHNESVRISRRRFLSQLGGLTALGMFGPSLLVSRDAQAQAGTAAAGGVQEGILTGSHWG
AIRATVVDGRFVAAKPFEKDSYPSKMVAGLPDHVHNTARIRYPMVRIDWMRKRHLSDTRQ
RGDNRFVRVSWDEALDLFYQELERIQTTYGPSALLSGSGWQSTGMFHNAAGMMGRALALH
GNSVGTGGDYSTGAAQVILPRVVGSMEVYEQQTSWPLVLKNSKTIILWGSDLLKNQQANW
WCPDHDVYQYYAQLKEKVANGEIRVVSIDTVVSSTHDYLGRDKVQHIAVNPQTDVPLQLA
LAHTLYSEKLYDAHFLDNYTVGFDQFLPYLLGTQDGQPKDAEWAAKLTGIDAETIRALAR
QMAAGRTQIIAGWCVQRMQHGEQWSWMIVVLAAMLGQIGLPGGGFGFGWHYNGAGTPSRK
GIILSGFSGATTIPPLHNSSDYRGASSTIPIARFIDAMLEPGKKIDWNGKQVTLPALKMC
VFAGTNPFHRHQQINRMIAGWQTLETVVAIDNQWTSTCRFADIVLPATTQFERNDLDQYG
NHSNRGILAMKQLVPPQFEARSDFDIFRELCRRFNREQAFTEGLDEMGWIKRIYQEGAQQ
GKGRGIHLPTFDAFWNGSGYIEFDDPQLFVRHQAFRDDPDLEPLGTPSGLIEIYSKSIAD
MHYGDCQGHPMWFEKAERSHGGPGSARFPLHLQSVHPDFRLHSQLCESPTLRAHYSVGGR
EPVFISPQDADARGIRNGDIVRVFNDRGQVLAGAVVSDRYVPGVIRIHEGAWYDPDRGGV
AGALCKYGNPNVLTLDIGSSRLAQATSAHTAIVEVEKYRGPLDPVTAFNGPQEMVAQCQY
VPLQTEETP
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgaaccataacgaaagtgtccgcatatcacgccgccgttttctgtcacagctcggcgga
ctcaccgccctgggcatgtttggcccctccctgctggtcagccgcgacgcgcaggcacag
gccggtacggccgccgcgggcggcgtacaggaagggatcctgaccggttcacactggggc
gccatccgcgccacggtggtggatggccgctttgtcgccgccaaaccctttgagaaggac
agctacccctccaagatggtggccggtctgccggatcatgtacacaatacggcccgtatc
cgctacccgatggtacggatcgactggatgcgcaagcgccacctcagcgatacgcgccag
cgcggcgataaccgcttcgtccgcgttagctgggacgaggcgctggatctgttctaccaa
gagctggagcgcatccagaccacctatggccccagcgccctgctgagcggcagcggctgg
cagtcgaccggcatgttccacaacgccgccggcatgatgggacgggcgctggcgctgcac
ggtaacagcgtgggcaccggcggtgactactcaaccggcgccgcccaggtgatcctgccg
cgggtcgtcggctccatggaggtctatgagcagcagacctcctggccgctggtgctgaaa
aacagcaagaccattattctgtggggctccgatctgctgaagaaccagcaggccaactgg
tggtgcccagatcacgatgtctatcagtactatgcccagctgaaagagaaggtcgcaaac
ggtgagatccgcgtcgtcagcatcgataccgtggtctcctctacccatgactacctgggg
cgcgacaaggtgcagcatatcgccgtcaatccccagaccgatgtgccgctgcagctggcg
ctggctcataccctgtacagcgagaagctgtacgacgcccacttcctggacaactacacc
gtcggcttcgaccagttcctgccctatctgctgggcacgcaggacggccagccgaaggat
gccgagtgggccgccaaactgaccggcatcgacgccgaaaccatccgtgccctggcgcgc
cagatggccgccggacggactcagatcatcgccggctggtgcgtacagcgtatgcagcac
ggcgagcagtggtcgtggatgatcgtggtgctggccgccatgctgggacaaatcggcctg
ccgggcggcggctttggctttggctggcactacaacggcgcgggcaccccgagccgcaaa
gggatcatcctcagcggcttctccggcgccaccaccatcccgccgctgcacaacagcagc
gactaccgcggcgccagcagcaccattcccatcgcccgctttatcgatgccatgctggag
ccgggcaaaaaaatcgactggaacggtaaacaggtgaccctaccggcgctgaaaatgtgc
gtcttcgccggcaccaacccgttccaccgtcaccagcagatcaaccgcatgatcgccggc
tggcagacgctggagaccgtcgtcgccatcgacaaccagtggacctccacctgccgcttc
gccgacatcgtcctgccagccaccacccagtttgagcgcaacgatctggatcagtacggc
aaccactccaaccgcggcattctggcgatgaaacagctggtaccgccccagtttgaggcg
cgtagcgacttcgatatcttccgcgagctgtgccgacgctttaaccgtgagcaggccttc
accgaagggctggacgaaatgggctggatcaagcggatctatcaagagggcgcgcagcag
ggcaaaggccgcgggatccacctgccgacgtttgacgccttctggaacggcagcggctat
atcgagtttgacgatccgcagctgttcgtgcgtcatcaggccttccgcgacgatccggat
ctggagccgctgggcaccccgagcggcctgatcgagatctactccaagagcattgccgat
atgcactacggcgactgccagggccacccgatgtggttcgaaaaggccgaacgctcccac
ggcggccccggctcggcgcgctttccgctgcacctgcagtcggtgcacccggacttccgt
ctgcactcgcagctgtgcgaatcgccgacgctgcgggcgcactacagcgtcggtggacgc
gagccggtctttatcagtccgcaggacgccgacgcgcgcgggatccgcaacggcgatatc
gtccgggtattcaacgatcgcggccaggttctggccggggccgtggtctccgatcgctat
gtacccggggtgatccgcatccacgaaggcgcatggtacgacccggaccgcggcggcgtg
gcgggggccctgtgtaaatacggcaaccccaatgtcctgacgctggatatcggctcttcg
cggctggcccaggccaccagcgcccataccgccatcgtcgaggtggagaagtaccgcggc
ccgctggatccggtcaccgccttcaatggcccgcaggagatggtggcgcagtgtcagtac
gtaccgctgcagacggaggagacgccatga

DBGET integrated database retrieval system