KEGG   Edwardsiella piscicida C07-087: ETAC_01290Help
Entry
ETAC_01290        CDS       T02509                                 

Definition
(GenBank) trimethylamine N-oxide reductase cytochrome c-type subunit
  KO
K03532  trimethylamine-N-oxide reductase (cytochrome c), cytochrome c-type subunit TorC
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_01290
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_01290
Transporters [BR:etc02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   ETAC_01290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_NNT Cytochrome_C7 Cytochrom_c3_2 Cytochrome_CBB3 Paired_CXXCH_1 DHC IRF-2BP1_2 Cytochrom_CIII GF_recep_IV
Motif
Other DBs
NCBI-ProteinID: AGH72391
Position
complement(306542..307699)
Genome map
AA seq 385 aa AA seqDB search
MKNLWNRLNRPSARWSVLALLALGIVIGLALIVLPHVGIKLTSSTEFCVSCHSMQPVYQE
YKQSVHFKNASGVRAECHDCHIPPDVPGMVKRKLEASNDIYQTFIAHSIDTPEKFEAKRA
ELAEREWKRMKENNSATCRSCHNYDAMDHAKQHPEAAKQMAIAAKDNQSCIDCHKGIAHQ
LPDMSSGFRKQFAELRQTASDDGNTLYTLDMKPIYAAKGDKEPAGSLLPASEVTVLKRDG
DWLQVQIEGWTETNGRQRVLSLLPGKRIFVSSIRDQVQQNAKTLEKTTVAATGVEWSKLQ
TTAWVQKGDLVNNIKPIWAYADALYNGTCNQCHGAPEKAHFDANGWIGTLNGMIGFTSLD
KREERTLLKYLQMNASDTGGADQKH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctatggaacaggctgaatcgccccagcgcgcgctggtcggtactggcgctg
ttggcgctgggcatcgtcatcggcctggcgctgatcgttctgccgcacgtcggcatcaag
ctgaccagcagcaccgagttctgcgtcagctgccacagcatgcagccggtctaccaagag
tataagcagtcggtacatttcaaaaacgcctccggcgtgcgcgccgagtgccatgactgc
cacattccccccgatgtgccgggcatggtgaaacgtaaactggaagccagtaacgatatc
taccagaccttcatcgcccattcgatcgacaccccggagaagttcgaggccaagcgcgcc
gagctggccgagcgggagtggaagcggatgaaagagaataactcggcgacctgccgctcc
tgtcataactatgatgcgatggatcacgccaagcagcatccggaggccgccaagcagatg
gccatcgccgccaaggataatcagtcctgcatcgactgtcataagggcattgcgcatcag
ctgccggacatgagcagcggcttccgcaagcagtttgccgagctacgtcagacggccagc
gatgacggcaacaccctgtacaccctggatatgaagccgatctacgccgccaaaggcgac
aaagagccggccggctccctgctgcccgcctccgaagtcaccgtgctgaagcgcgacggc
gactggctgcaggtgcagatcgaaggctggacggagaccaatggccgccagcgcgtgctg
tccctgctgccgggcaaacgtatcttcgtctcctctatccgtgaccaggtacagcagaac
gccaagacgctggagaaaaccaccgtcgccgccaccggcgtagagtggagcaagctgcag
accaccgcctgggtacaaaagggcgacctggtcaataacatcaagccgatctgggcctat
gccgatgcgctgtacaacggcacctgcaaccagtgccacggcgcgccggagaaagcacac
tttgacgccaacggctggattggcaccctcaacggcatgatcggcttcaccagcctggac
aagcgggaagagcgcaccctgctcaaatatctgcaaatgaacgcctcagacaccggcggc
gccgatcagaaacactaa

KEGG   Edwardsiella piscicida C07-087: ETAC_10790Help
Entry
ETAC_10790        CDS       T02509                                 

Definition
(GenBank) Functional role page for Cytochrome c-type protein TorY
  KO
K03532  trimethylamine-N-oxide reductase (cytochrome c), cytochrome c-type subunit TorC
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_10790
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_10790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10790
Transporters [BR:etc02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   ETAC_10790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_NNT Cytochrome_C7 Cytochrom_c3_2 Paired_CXXCH_1 DHC GF_recep_IV PUA_2 Wzy_C
Motif
Other DBs
NCBI-ProteinID: AGH74279
Position
2448237..2449406
Genome map
AA seq 389 aa AA seqDB search
MSNRYAAPGRRRRWPWLVLLGIILGIALLAATFTVLHKTSSTEFCVSCHTMQQPLAEYQG
SVHFQNKPGIRAECADCHIPQQPLDFLKTKVLALKDVYGELTGKIDTPEKYQAHKLAMAQ
SVWNTMKANDSATCRSCHSYQAMDIIDQSAEARKQHPVAIKDGETCIDCHKGVAHILPDM
SALGAAGASELAAAAAKTPDGARTLYAISTQPFFLAPQAGAHSDGSLIPSTEIRVLQRRG
DMVEGELSGWQQNGVNQVIYAAQGKRILSALLGEAARKQVKVLSSDTDAATGLVWHRVTL
SIWLPKANLIGSEQPIWRYAADMMSANCTGCHGLTALDRFNANQWIGVVKGMASRTSLNE
EQLRLLTQYVQKHASDMSANGADQPKEPK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgttacgccgcccccgggcgacgccggcgttggccgtggctggtgctgctg
gggatcatcctcggtatcgccctactggctgcgaccttcaccgtcctgcacaaaaccagc
agcaccgagttttgtgtctcctgccataccatgcaacagcctctggccgaatatcagggc
agcgtccacttccagaataagccggggatccgggccgagtgcgccgactgccatatcccg
cagcagcccctcgacttcctgaagaccaaggtactggcgctgaaggatgtctacggcgag
ctgaccggtaaaatagatacaccagagaaataccaggcccacaagctggccatggcgcag
agcgtctggaacaccatgaaagccaacgactccgccacctgtcgctcctgccatagctac
caggccatggacatcatcgatcagagtgcggaggcccgcaaacagcaccccgtcgccatc
aaggacggggaaacctgtatcgactgtcataagggggtcgcccatattctgccggatatg
agcgccctgggcgccgccggcgctagcgaactggccgccgccgccgcgaaaacccctgac
ggcgcccgcacgctctacgccatatcaacccagcccttcttcctggcgccgcaggccggg
gcccacagcgatggcagtctgataccatcgacggagatccgggtgctgcagcgccgcggg
gacatggttgagggtgagctgagcggttggcagcagaatggcgttaaccaggtgatctat
gcagcgcagggcaagcgtatcctctccgcgctgctgggagaggcggcacgcaaacaggtg
aaagtgctgtccagcgacaccgacgccgcgaccggactggtatggcaccgggtaacgctg
tccatctggctgcccaaggccaatctcatcggcagtgaacagcccatctggcgctatgcc
gccgatatgatgtcggccaactgcaccggctgccacggcctgaccgcgttggatcgcttc
aacgccaaccaatggatcggggtcgtgaaaggcatggcatcgcgcacctcgctgaatgaa
gagcagctgcgcctgctgacccaatatgtccaaaaacacgccagcgatatgtccgctaac
ggtgcagatcaacccaaggagcctaagtga

DBGET integrated database retrieval system