KEGG   Edwardsiella piscicida C07-087: ETAC_01295Help
Entry
ETAC_01295        CDS       T02509                                 

Definition
(GenBank) DNA-binding transcriptional regulator TorR
  KO
K07772  two-component system, OmpR family, torCAD operon response regulator TorR
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00455  TorS-TorR (TMAO respiration) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_01295
Two-component system [BR:etc02022]
 OmpR family
  TorS-TorR [MD:M00455]
   ETAC_01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AGH72392
Position
307837..308526
Genome map
AA seq 229 aa AA seqDB search
MTHHIVIVEDEPVTQARLRDYFVQEGYQVSVTASGAGLRELMLLQPVDVILLDINLPDEN
GLMLTRALRERSTVGIILVTGRCDRIDRIVGLEMGADDYVTKPLELRELVVRVKNLLWRI
DLARQAQPAADNCYLFAGYCLNVSRHTLTLDDEPIRLTRAEYEMLLAFVTNPGAILSRER
LLRMLSSHRVDSPDVRTVDVLIRRLRAKLRPDLFVTQHGEGYFLAAEVA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaccacattgtgattgtggaagatgagccggtgacgcaggcgcgtttgcgcgac
tactttgtccaagagggataccaggtctcggtgaccgccagcggcgctgggctgcgcgag
ctgatgctgctgcagccggtcgatgtgatcctgctggatatcaatctgcccgatgagaac
ggactgatgctgacgcgcgcgctgcgcgagcgctcgacggtggggatcatcctggtcacc
ggccgctgcgatcgcatcgaccgtatcgtcggcctggagatgggggcggatgattacgtc
accaagccgctggagctgcgcgagctggtggttcgggtgaagaacctgctgtggcgcatc
gatctggcgcgccaggcgcagcccgcggcggataactgctatctgttcgccggctactgc
ctgaacgtgtcgcgccatacgctgacgctggacgacgagccgatccggctgacgcgcgcc
gagtatgaaatgctgctggcctttgtgaccaatcccggcgcaattttaagccgagagcgg
ctgctgcgcatgctttcatcgcaccgggtcgacagccccgatgtgcgcacggtggatgtc
ttaatccgccgtctgcgcgccaagctgcgccccgatctgttcgtgacccagcacggcgag
ggctattttctggcggccgaggtcgcctga

DBGET integrated database retrieval system