KEGG   Edwardsiella piscicida C07-087: ETAC_01305Help
Entry
ETAC_01305        CDS       T02509                                 

Definition
(GenBank) hybrid sensory histidine kinase TorS
  KO
K07647  two-component system, OmpR family, sensor histidine kinase TorS [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00455  TorS-TorR (TMAO respiration) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_01305
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_01305
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_01305
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_01305
Two-component system [BR:etc02022]
 OmpR family
  TorS-TorR [MD:M00455]
   ETAC_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA Response_reg Hpt HAMP T3SS_ExsE HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AGH72394
Position
309648..312440
Genome map
AA seq 930 aa AA seqDB search
MGTPSLTRRLWLAFALMAALTLGSVLVGWFSLHYVGRVEQANTQALLPTMNMARQLSEAG
AYELFSAQSLSNADSEREWLAQGRMLTAQSLKISRLLDELRRQGFDIDTIAQQETEITRS
LGEQGALVGQRLQLRMRARALSAQVAAAAEQIAELAKGQASNAATAAGATQAGIYDLIEQ
RRAAAAEQALDRLIDIDLEYLNQMSELRLSALRVQQMIMALESDSGRLALSEQEERLAQA
LRILQRRQQRVEDPRIRAQIAQALGQVAQYRTLVDLYRQDNDIYARLQALSQNNLDLFTR
FSAEISRQVSDIELRNAAALEHLQQARRLGLTWLTLLGGAGLLALCLILWRVVYRSLSQP
LAHQTAALQRLLDGDFDSPFPDRAGVRELDTIGRLMEAFRTSVRALRHQRQHLADLVQMR
TAELQALVVEHRQARAEAENADRAKSAFLAAMSHEIRTPLHGILGTAQLLAEQPISPQSR
GYVQAINDSGESLLAVLNDVLDYSAIEAGSSSVVLNDEPFSPRQLLDSLLRLAEGRLRDR
PLRLAHDYADALPAWLQGDPRRIRQIVMNLLNNALRFTERGVICVSCGCDETHWWIAVQD
SGCGIDPAQQAAIFQPFVQLSARRGGTGLGLAICRGLAQAMAGSLELSSTPGKGSRFCLR
LPLRRAALPPPEAPAQAWSLVGRRLLLIEDNPLSQRISAEMLQSAGVQVHIAGSAAEAQA
LLARDTAFDAALVDFDLPDSDGPTLARQMAEAYPQLKRIGFSAHVLDEAQHRRIRPLFCG
MIQKPVPRAELCRLIAHALADGEHSTVRPTRVVRQIAAPLDDEQLAEDVATFGQPRLTEW
LALFRQHSLPLLAEIAAARAAGDADQVKGLAHRLKSSCASLGMRGAADACLALERSPLTA
AALDEPIREGLAALEAWLAKVSESDDGKIT
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggggacgccttctctgactcgccggctatggctggcttttgcgctgatggcggcgtta
accctgggcagcgtgctggtgggctggtttagcctgcactacgtgggccgggtggagcag
gccaatacgcaggccctgctgccgaccatgaacatggcgcgccagctgagcgaggccggt
gcctatgagctgttttcggcccagagcctgagcaatgcggacagcgaacgggagtggctg
gcccaggggcggatgctgacggcgcagagcctgaagatcagccgtctgctggatgagctg
cgccgccagggattcgatatcgataccatcgcccagcaggagacggagatcacccgttcg
ctgggagagcagggggcgctggtgggtcagcgtctgcagctgcgtatgcgtgcgcgggcg
ctcagcgcgcaggtggcggcggcggcagagcagattgccgagctggccaaagggcaggcc
agcaacgcggcgacggccgccggtgcgacccaggcgggtatctatgatctgattgagcag
cggcgggcagcggcggcggagcaggcgctggatcggctgatcgatatcgatctggagtac
ctgaatcagatgagcgagctacgcctgagcgcgctgcgggtccagcagatgatcatggcg
ctggagagcgacagcggccgtctggcgctgagcgaacaggaggagcgcctggcacaggcg
ctgcgcatcctgcagcgccgccagcagcgggttgaggatccgcgcattcgcgcccagata
gcgcaggcgctggggcaggttgcgcagtaccgtacgctggtcgatctgtaccgccaggat
aatgatatttacgcccggctacaggcgctgtcacagaacaatctggatctctttacccgc
tttagcgcggagataagccgccaggtgagcgatattgagctgcgcaatgccgccgcacta
gagcacctgcagcaggcgcgtcgtctggggttgacctggctgacgctgctggggggcgcc
gggctgctggcgctgtgcctgatcctgtggcgcgtggtttaccgctcgctctctcagccg
ctggcccatcagacggccgcgctgcagcgcctgctggacggcgacttcgactcccccttt
cccgatcgcgccggggtgcgcgagctggatactatcggacgtcttatggaggcatttcgc
accagcgtacgcgccctgcgtcatcagcgtcagcatctggccgatctggtacagatgcgc
accgccgagctgcaggcgctggtggttgagcaccgtcaggcccgcgcagaggcggagaac
gccgatcgggccaagtcggcgtttctggcggcgatgagccacgagatccgtacgccgctg
cacggcattctgggcaccgcccagctgctggcagagcagccgatctctccccagagccgg
ggctatgtccaggcgatcaacgactccggtgagtcgctgctggcggtgttgaacgatgtg
ctggactattcggctatcgaagccggcagcagtagcgtggtgctaaacgatgagccgttt
tcaccgcgccagctgctggacagtctgctgcgtctggcggaggggcggctgcgcgatcgt
ccgcttcgcctggcgcatgactacgctgatgcgttaccggcctggctgcagggcgatccg
cgccggattcgccagatcgtcatgaacctgctgaacaacgccctgcgttttaccgagcgc
ggggtgatttgcgtgagctgcggctgcgatgagacgcactggtggatagcggttcaggac
agcggctgcggcatcgacccggcgcagcaggcggccatatttcagccatttgtgcagctg
agcgcccgacgcggcggtacggggctggggttggccatctgccgcggcctggcgcaggcc
atggcgggaagtctggagctgagcagtaccccgggcaaggggagccgcttttgcctgcgt
ttaccgctgcgtcgggcggcgctgccgccgccggaggcgcctgcgcaggcatggtcgctg
gtcggtcgccgtctgctgctgatcgaggataatccgcttagccagcgtatcagcgcagag
atgctgcagagcgcgggcgttcaggttcatatcgccggtagcgccgcggaggcgcaggcc
ttactggcgcgggatacggcgttcgatgcggcgctggtggattttgatctgccggacagc
gacggacctacgctggcgcgccagatggcagaggcctacccgcagctgaagcgcatcggt
tttagcgcgcatgtgctggatgaggctcagcatcgacggatccgtccactgttttgcggc
atgatccaaaagccggtgccgcgggcagagctgtgtcgcttgattgcccatgcgctggcc
gacggtgagcacagtactgtgcgaccgacccgcgtagtgcggcagatcgcagcaccgctg
gatgacgaacagctagcggaggatgtggcgacctttggccagccgcgcctgacggagtgg
ctggcgctgtttcgtcagcactcgctaccgctgctggctgagattgcagcggcccgcgcc
gcgggagacgccgaccaggtgaaggggcttgcgcaccgcctgaagagcagctgtgctagc
ctgggaatgcgcggcgcagcggatgcctgcctggcgctggagcgatccccgctgacggcg
gcggcgcttgacgagccgatccgggagggactggcggcgctggaggcatggctggcgaaa
gtctcagaatcggatgacggcaagataacgtga

DBGET integrated database retrieval system