KEGG   Edwardsiella piscicida C07-087: ETAC_01455Help
Entry
ETAC_01455        CDS       T02509                                 

Definition
(GenBank) fumarate reductase subunit D
  KO
K00247  fumarate reductase subunit D
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00190  Oxidative phosphorylation
etc00620  Pyruvate metabolism
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc02020  Two-component system
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etc_M00150  Fumarate reductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_01455
   00620 Pyruvate metabolism
    ETAC_01455
   00650 Butanoate metabolism
    ETAC_01455
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_01455
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fumarate_red_D
Motif
Other DBs
NCBI-ProteinID: AGH72424
Position
complement(355781..356137)
Genome map
AA seq 118 aa AA seqDB search
MNNKVYKRSDEPVFWGLFGAGGMWGAIFAPAVILIVGILLPLGMFPDALTFERALSFSQS
IIGRIFWLLMIILPLWCGLHRLHHMMHDLKIHVPAASWVFYGLAAILSVVALIGIFTL
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaagtctacaaacgttctgacgagccggttttttggggtctgtttggcgca
ggcggtatgtggggagctatcttcgcgccggccgtgatcctgatcgtcggcattctgctg
ccgctggggatgttcccggatgcgctgacctttgagcgcgccctgagcttcagccagagc
atcattggccgtatcttctggctgctgatgatcattctgccgctgtggtgtggtctgcac
cgtctgcatcacatgatgcacgatctgaagatccacgtgccggcagccagctgggtattc
tatggcctggcggccattctgagcgtagtggcgctgatcgggatctttaccctgtaa

DBGET integrated database retrieval system