KEGG   Edwardsiella piscicida C07-087: ETAC_01490Help
Entry
ETAC_01490        CDS       T02509                                 

Definition
(GenBank) GTPase RsgA
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00730  Thiamine metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ETAC_01490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:etc03009]
    ETAC_01490
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     ETAC_01490
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     ETAC_01490
Ribosome biogenesis [BR:etc03009]
 Prokaryotic Type
  GTPases
   ETAC_01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsgA_GTPase MMR_HSR1 FeoB_N AAA_16 GTP_EFTU ABC_tran AAA_29 AAA_22 RNA_helicase MMR_HSR1_Xtn AAA_23
Motif
Other DBs
NCBI-ProteinID: AGH72431
Position
complement(365000..366043)
Genome map
AA seq 347 aa AA seqDB search
MSKKRLSHGQQRRVHANHQRRLQQTDNSAEMDDSLFGDAQDGIVVSRFGKHADVEAADGT
QQRCNIRRTLPSLVTGDRVVWRAALQAGSKGIVEAVHPRSSVLTRPDYYDGVKPIAANID
QIVIVSAILPELSLNIIDRYLVACETLCVEPLIVLNKVDLLDDEGREFVEQAMAIYRHIG
YRVVLVSSHSGEGMAQLQALLTQRISIFAGQSGVGKSSLLNALLPALESQIEVGAVSDNS
GLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLDAEQITQGFIEFRDYLGSCKFRDCK
HGNDPGCALREAVARGDIAETRFDNYHRILEGMAQVKLRKNFGNGDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaagaaaagactatcgcacggccagcagcgacgggtgcatgccaatcaccagcgt
cgtctgcagcagacggacaatagcgcagagatggacgacagcctgttcggtgacgcccag
gacgggattgtcgtcagccgtttcggcaaacatgccgacgttgaggccgccgatggcact
cagcagcgctgcaacatccgccgtaccctgccatcgctggtgaccggcgatcgggtggtc
tggcgcgccgcgctgcaggccggcagcaaagggatcgtcgaggccgttcatccgcgcagc
tcggtactgactcgcccggactactacgatggggtaaagcccatcgccgccaatatcgat
cagatcgtcatcgtctcggctatcctgccggagctgtcgctgaacatcatcgatcgctat
ctggtcgcctgtgaaaccctctgcgtcgagccgctgatcgtgctgaacaaggtcgacctg
ctggacgacgaggggcgcgagtttgtcgaacaggcgatggcgatctaccgccacatcggc
taccgggtcgtactggtctccagccacagcggcgaaggcatggcgcagctgcaggcgctg
ctcacccagcgcatcagcatcttcgccggccaatccggcgtgggcaaatccagcctgctc
aacgcgctgctgccggcgctggagagccagatcgaggtcggcgccgtctccgataactcc
ggtttgggccagcacaccaccaccgcggcccgcctgtatcactttccgcacggcggtgac
gtgatcgactcgcccggcgtccgtgaatttggtctgtggcatctggatgcggagcagata
acccaaggattcattgagttccgtgactacctgggcagctgcaagttccgcgactgtaaa
cacggcaacgatccgggctgtgccctgcgagaggcggtcgcgcgcggcgatatcgcagaa
acgcgctttgacaactatcatcgtattcttgaggggatggcgcaggttaaactgcgtaag
aacttcggcaacggcgacagctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_08640Help
Entry
ETAC_08640        CDS       T02509                                 

Definition
(GenBank) thiamine kinase
  KO
K07251  thiamine kinase [EC:2.7.1.89]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00730  Thiamine metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ETAC_08640
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.89  thiamine kinase
     ETAC_08640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase
Motif
Other DBs
NCBI-ProteinID: AGH73849
Position
complement(1966720..1967562)
Genome map
AA seq 280 aa AA seqDB search
MRSDPQAMRAVLRRRFPSLPGADWQFSLTQGLSGDNWRAQNGDSVTILLRPITPPRRHLG
IDRRREGRALRMGAAAGLGPTCYGTVDGWLLAGWLPGETLAPGALSMAQLAALVVRLHRL
PPRLTSRSLRRYCAAYWAQLAPERRGFLAQRVHQRWQRRREPRPLKLALLHMDIHDGNLI
GADGAVGLIDWEYAASGDIALDLAALSRNYALDGAGRAELVAAYCRQGGYRDAACLLQQL
NRWLGWVDYMAWLWFELRWQQTQQPIYRRQADVLLRNLTQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctctgatccgcaggccatgcgggcggtgctgcgtcgccgctttccctcgctgccg
ggcgccgattggcagtttagcctgacgcaggggctgagcggcgataactggcgcgcgcag
aatggtgacagcgtcaccattctgctgcgaccgatcacgccgccgcggcgccatctgggg
atcgatcggcgccgcgaggggcgggcgctgcggatgggggcggcggcggggctggggcca
acctgctatggcaccgttgatggctggctgctggccggctggctgcccggcgagaccctg
gcgccgggtgcgctgtcgatggcgcagctggcggcgctcgtcgtgcgtctgcaccgcctg
ccgccgcgtctgacgtcgcgctcgctgcgacgctactgcgccgcctactgggcgcagctg
gcgcccgagcggcgtggctttctggcgcagcgcgtgcaccagcgctggcagcgccgccgt
gagccgcgtccgcttaagctggcgctgctgcatatggatattcacgatggcaatctgatc
ggcgcggacggcgccgtggggctgatcgactgggagtacgccgccagcggcgatatcgcg
ctggatttagcggcgctgagccgaaactatgccctggacggcgccgggcgggccgagctg
gtcgcggcctactgtcgtcaggggggctaccgtgacgccgcgtgtctgctgcagcagctg
aatcgctggctgggctgggtggactatatggcctggctgtggtttgaactgcgctggcag
cagacgcagcaacctatttaccggcggcaggccgatgtcctgctgcgcaatttaactcaa
taa

KEGG   Edwardsiella piscicida C07-087: ETAC_13900Help
Entry
ETAC_13900        CDS       T02509                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00730  Thiamine metabolism
etc00790  Folate biosynthesis
etc01100  Metabolic pathways
etc02020  Two-component system
Module
etc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ETAC_13900
   00790 Folate biosynthesis
    ETAC_13900
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_13900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_13900
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:etc00537]
    ETAC_13900
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ETAC_13900
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAC_13900
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:etc00537]
 Enzymes
  ETAC_13900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AGH74901
Position
complement(3131018..3132460)
Genome map
AA seq 480 aa AA seqDB search
MASHTPFSLSLLMLSLSLALPLQAAPAAPSAEQVLTERAARGDITQRGGARRLLGDQTAA
LQASLSARPAKNVILLIGDGMGDAEITAARNYAAGAGGMLRGIDALPLTGQYTHYSLDRQ
THRPNYVTDSAASATAWSSGVKTYNGALGIDVTGKSHPTLLELARAAGKATGNVSTAELQ
DATPAAMFAHVSGRKCYGPQQTLATCPENALDNGGAGSITEQMLKARADVTLGGGAKTFA
QTVSAGAFKGKTLLQQAQAQGYHIVSNLDEMNAVTEADDRRPLLGLFAEGNMPVRWLGPK
ATRHGNQQAPVTCQPNPQRSDSQPSLAQMTEKAISLLSKNPNGFFLQVEGASIDKQDHAA
NPCGQFGETVDLDEAVQKALAFARRDGNTLVVVTADHAHTSQIVPNDAKAPGLTQTLITQ
DGVPMTISYGTAEEADSQEHTGSQLRIAAYGPHGANVVGLTDQTDLFFTLRDALGLKTAP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccatacccctttctccctttctttactgatgctttctcttagcctggccctg
ccgctgcaggccgcgcccgctgcgccgagcgcagagcaggtgctgaccgaacgcgccgcg
cgcggcgatattacccagcggggcggcgctcgccgtctgctcggcgatcagaccgcggcg
ctgcaggcgtcgctgagcgcccgtccggccaagaacgtgatcctgctgatcggcgatggc
atgggggatgcggagatcaccgccgcccgtaactatgcggccggcgcgggcggaatgctg
cgcggtatcgatgccctgccgctgaccgggcagtacacgcactattcgctggatcgccaa
acccatcgaccgaactatgtcaccgactcggcggcctcggcgaccgcctggagcagcggg
gtaaagacctataacggcgccttgggcatcgatgtgacgggcaagtcccacccgacgctg
ctggagctggcgcgcgcggcgggcaaggcgaccggaaacgtctcgactgcggagctgcag
gacgccacgccggcggcgatgttcgcccacgtcagcggacgcaaatgctatggtccgcag
cagaccctggcgacgtgcccagagaacgccctggataacggcggcgccggatcgatcacc
gagcagatgctgaaggcgcgcgccgatgtgacgctgggcggcggggcgaagacctttgcg
cagacggtgagcgcgggggcatttaaggggaagaccctgctccagcaggcgcaggcgcag
ggctaccacatcgtcagcaatctggatgagatgaacgccgtcacggaggccgatgatcgg
cgtcctttgctgggcctgttcgccgagggcaacatgccggtgcgctggctggggcccaag
gccacgcggcacggcaaccagcaggcgccggtgacctgtcagccgaacccgcagcgcagc
gacagccagccgagcctggcgcagatgaccgagaaggccatctcattgctgagcaagaat
cccaacggctttttcctgcaggttgagggggcatcgatcgataaacaggatcacgccgcg
aatccgtgcggtcagtttggcgagacggtcgatctggatgaagcggtgcagaaggcgctg
gcgttcgcccgccgcgatggcaacaccctggtggtggtcacggccgaccacgcccacacc
agccagatcgtgcccaacgacgccaaggcgccggggctgacgcagacgctgatcacccag
gatggggtaccgatgaccatcagctacggcaccgcagaagaggcggatagccaggagcat
accggctctcagctgcgcatcgccgcctacggtccccacggagccaacgtggtcggcctg
acggatcagaccgatctgttctttaccctgcgcgacgcgctgggactgaaaaccgccccc
taa

DBGET integrated database retrieval system