KEGG   Edwardsiella piscicida C07-087: ETAC_01560Help
Entry
ETAC_01560        CDS       T02509                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00250  Alanine, aspartate and glutamate metabolism
etc01100  Metabolic pathways
Module
etc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_01560
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_01560
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     ETAC_01560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AGH72445
Position
381405..382703
Genome map
AA seq 432 aa AA seqDB search
MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVVSIIANGVVLAPDALLREMTELEARGVPVRERLLLSEACPLILPYHVALDNAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKESFAVKLKEIMEYHNFQLVNYYHVD
AVDYQRVLDEVMAVADLLTSMVVDVADLLNKAYRNGEYVMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGVGPRCVDYVLGIVKAYSTRVGAGPFPTELFDSVGEFLCEKGNEFGA
TTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLDEVKICVGYRLPDGREVDVTP
LAAEGWEGIEPIYEVLPGWKESTFGVKQRDGLPQAALNYIKRIEEVTGVPVDIISTGPDR
EETIVLRHPFDA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaacgtcgtcgtactgggcacccaatggggtgacgaaggtaaaggtaaggtc
gtagacctcttaactgaacgggccaagtatgttgtacgctatcagggcgggcacaacgcg
ggccatacgctagtcattaacggtgaaaaaaccgttctgcatctgattccctcaggtatt
ctgcgcgaaaatgtcgtcagtattattgccaacggcgttgttctggcgccggatgcgctg
ctgcgcgaaatgaccgagctggaagcgcgcggtgtaccggtgcgcgagcgcctgctgctc
tctgaagcctgtccgctgatcctgccgtatcacgttgcgctggacaatgcgcgagagaaa
gcgcgcggtgccaaggctatcggcaccaccggtcgcggcatcggcccggcctatgaagac
aaagtcgctcgccgcggcctgcgcgtcggcgacctgtttgataaagaaagcttcgccgtt
aagctgaaagagattatggaataccataacttccagctggtgaactactaccacgtcgat
gccgttgattaccagcgcgtgctggacgaagtgatggcggttgctgacctgctgaccagc
atggtggttgacgttgccgatctgctgaacaaggcctatcgcaacggcgaatatgtgatg
ttcgaaggtgcccagggcactctgctggatatcgaccacggtacctatccgtacgtgacc
tcctccaacaccaccgccggtggcgtggcgaccggttccggcgtcggtccgcgctgtgtg
gactatgtgctgggtatcgtgaaagcgtactctacccgcgtgggcgcgggtccgttcccg
acggagctgttcgatagcgtcggcgagttcctgtgcgagaagggcaacgagtttggtgcc
accaccggccgtcgccgtcgcaccggctggctggacgccgttgccgtgcgccgcgccgtc
gagctgaactcgctgtctggcttctgcctgaccaagctggatgtgctggatggtctggat
gaagtgaaaatctgcgtaggctatcgcctgccggatggccgcgaagtcgacgtaacgccg
ctggccgccgagggctgggaaggcattgagccgatctacgaagtgctgccgggctggaaa
gagagcaccttcggcgtgaagcagcgtgacggtctgccgcaggcggcgctgaactacatc
aaacgcattgaagaggttaccggtgtaccggtcgatattatctctaccggtcccgaccgc
gaagagacgatcgttctgcgtcacccgttcgacgcgtaa

DBGET integrated database retrieval system