KEGG   Edwardsiella piscicida C07-087: ETAC_01685Help
Entry
ETAC_01685        CDS       T02509                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00030  Pentose phosphate pathway
etc00051  Fructose and mannose metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_01685
   00030 Pentose phosphate pathway
    ETAC_01685
   00051 Fructose and mannose metabolism
    ETAC_01685
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_01685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_01685
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     ETAC_01685
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAC_01685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-ProteinID: AGH72470
Position
complement(403926..404930)
Genome map
AA seq 334 aa AA seqDB search
MKTLGEFIVEKQQDFPHATGELTALLSAIKLGAKIIHRDINKAGLVDIIGASGAENIQGE
VQMKLDLYANEKLKAALKARGEVAGIASEEEDDIVIFEGDRANNAKYVVLMDPLDGSSNI
DVNVSVGTIFSIYRRITPLGTPVTREDFLQPGNRQVAAGYVVYGSSTMLVYTTGNGVHAF
TYDPSLGVFCLSHERLRFPHSGNMYSINEGNYIKFPLGVKKYIKYCQEQDSATQRPYTSR
YIGSLVADFHRNLLKGGIYIYPSTASHPQGKLRLLYECNPMSFLAEQAGGKATDGFRRIL
DIVPDALHQRCPFFVGSCAMVEDAERFMHQFPDA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgctaggcgagtttatcgtcgaaaaacagcaggattttcctcacgctaccggt
gagcttaccgctcttctctccgcaatcaagctgggtgccaaaattatccaccgcgatatc
aacaaggcggggctggtcgatatcatcggcgccagcggtgcggaaaatattcagggtgaa
gtgcagatgaagctggatctgtacgccaacgagaagctcaaggcagcgctgaaagcgcgc
ggtgaagtggccggcatcgcctcagaggaggaggatgacatcgtcatcttcgaaggcgat
cgcgccaataacgccaagtacgtggtgctgatggatcccctggacggttcgtccaatatc
gacgttaacgtctccgtcggtaccatcttctccatctatcgccggattaccccgcttggc
acaccggtcacccgcgaagacttcctgcagccgggcaatcgccaggtcgccgccggctat
gtggtctacggctcctccaccatgctggtctacacgaccggcaacggcgtccacgcgttt
acctacgatccctcccttggggtcttctgcctgtcccacgagcggctgcgtttcccgcac
agcggcaacatgtactccattaacgaaggcaactacatcaagttcccgctgggcgtgaag
aagtacatcaagtattgtcaggagcaggacagcgccacgcagcgcccctatacctcccgc
tatattggctccctggtggcggacttccaccgcaacctgctgaagggcggcatctatatc
tatccgagcaccgccagccatccgcagggtaagctgcgcctgctgtatgagtgcaacccg
atgtcattcctggcagagcaggccggaggcaaggccaccgacggcttccgccgcatcctg
gatatcgtgccggatgcactgcatcagcgctgcccgttctttgtcggcagctgcgccatg
gtagaagacgccgaacgtttcatgcatcagttccccgacgcataa

KEGG   Edwardsiella piscicida C07-087: ETAC_16335Help
Entry
ETAC_16335        CDS       T02509                                 

Gene name
glpX
Definition
(GenBank) fructose 1,6-bisphosphatase II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00030  Pentose phosphate pathway
etc00051  Fructose and mannose metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_16335 (glpX)
   00030 Pentose phosphate pathway
    ETAC_16335 (glpX)
   00051 Fructose and mannose metabolism
    ETAC_16335 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_16335 (glpX)
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     ETAC_16335 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AGH75388
Position
3699531..3700541
Genome map
AA seq 336 aa AA seqDB search
MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADGAAVNAMRIMLNQVDIDGEIVIGEGEI
DEAPMLYIGERVGSGQGDQVDIAVDPIEGTRMTAMGQANALAVMAVGDKGTFLHAPDMYM
EKLVVGPQAKGCVDLNLPLETNLRNIADRLGKPLSHLTVITLAKPRHDANIAAMQALGVR
VFAIPDGDVAASILTCMPESEVDVMYGIGGAPEGVVSAAVIRALDGDMQGRLLARHQVKG
DTPENRRLGEQELQRCEQMGICAGEVLALGDMARNDNVIFSATGITKGDLLEGIYRKGNV
ATTETLLIRGKSRTIRRIRSTHYLERKDAQIRDIIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaattagccatcgagttctctcgcgtcaccgaagcagcggcactggccgga
tataagtggttagggcgcggcgacaaaaatgcggcagacggcgccgcggtcaacgccatg
cgcatcatgctcaatcaggtcgatatcgacggggagatcgtcatcggcgagggggagatc
gacgaggcaccgatgctgtacattggtgagcgcgtcggcagcggccagggcgatcaggtc
gacatcgccgtcgacccgattgagggaacccgcatgaccgccatgggccaggccaacgcg
ctggcggtgatggccgtcggcgataaaggaaccttcctgcatgcgccggatatgtacatg
gagaagctggtcgtcggccctcaggccaaaggctgcgtcgatctcaatctgccgctggag
accaacctgcgcaacatcgccgaccgcctgggcaagccgctgtcccatctgacggtgatc
accctggctaagccgcgtcatgacgctaacatcgccgcaatgcaggcgttgggcgtacgc
gtctttgccattcccgacggcgacgtcgcggcctcgatcctgacctgcatgccggaaagc
gaagtggacgtcatgtatggcatcggcggagcgccggaaggggtcgtctccgccgcggtg
atccgcgcgctggacggcgacatgcagggccgtctgctggcccgccaccaggtgaagggc
gatacgccggagaaccgccgtctgggcgaacaggagctgcagcgctgtgagcagatgggg
atctgcgccggtgaggtgctggccctcggcgacatggcgcgcaacgataacgtgatcttc
tccgccaccgggatcaccaagggtgacctgctggagggcatctatcgtaagggcaacgtc
gccaccaccgaaaccctgctgatccgcggtaagtcccgcaccattcgccgtatccgctcg
acccactatctggagcgcaaagacgcccagatccgcgatatcattctgtaa

DBGET integrated database retrieval system