KEGG   Edwardsiella piscicida C07-087: ETAC_01705Help
Entry
ETAC_01705        CDS       T02509                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00270  Cysteine and methionine metabolism
etc00620  Pyruvate metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_01705
   00620 Pyruvate metabolism
    ETAC_01705
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_01705
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_01705
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_01705
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     ETAC_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AGH72474
Position
408139..409077
Genome map
AA seq 312 aa AA seqDB search
MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVTVRGFGG
EDASPALEGADIVLISAGVARKPGMDRSDLFNVNAGIIRNLIGQVARTSPNACIGIITNP
VNTMVPIAAEVLKKAGVYNPNKLFGVTTLDIIRSNTFVGELKHLDPTTLDIPVIGGHSGV
TILPLLSQIPGASLSEQEVADLTKRIQNAGTEVVEAKAGGGSATLAMGQAAARFALSLVR
AMQGDENVVECGYVESDGEYARFFAQPLLLGKEGLVQRLNIGTLSAFEQHALESMLEVLR
KDIALGEDFINK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgcggttctcggcgcagcgggtggcatcggccaggcgctcgctcttctgctt
aagactcagctgccttcaggttcagaactctccctttacgatatcgccccggtaacgccg
ggcgtcgccgttgatctcagccatatacctacggcggtcacggtgcgcggtttcggcggt
gaggatgcctcccccgccctagagggcgcggatatcgtgctgatttctgccggtgtggcc
cgtaagccggggatggatcgttccgatctgttcaacgttaacgccggcatcatccgtaac
ctgatcggacaggttgcgcgtaccagcccgaacgcctgcatcggtatcatcaccaacccg
gtgaataccatggtgccgattgcggctgaggtgctgaagaaggcgggggtatataacccg
aacaaactgttcggcgtgacgacgctggatatcatccgctccaacaccttcgtcggtgag
ctgaagcacctggatccgacaacgctggatattccggtgattggcggtcactccggcgta
acgattctgccgctgctctcgcagatcccgggtgctagcctcagcgaacaagaggtggct
gatctgaccaagcgtattcagaacgctggcaccgaggtggtagaggcgaaggccggcggc
ggatcggcaaccttggccatgggccaggcggcggcgcgcttcgcactgtcgctggtgcgg
gcgatgcagggcgatgaaaacgtcgtggagtgcggctacgtcgagagcgacggcgaatat
gcccgcttctttgctcaaccgctgctgctgggtaaagaggggctggtacagcgcctgaat
atcggcacgctgagcgcctttgaacagcatgcgttggagagcatgctggaggtgctgcgt
aaagatatcgcgctgggcgaagactttatcaataagtaa

DBGET integrated database retrieval system