KEGG   Edwardsiella piscicida C07-087: ETAC_01715Help
Entry
ETAC_01715        CDS       T02509                                 

Definition
(GenBank) octaprenyl-diphosphate synthase
  KO
K02523  octaprenyl-diphosphate synthase [EC:2.5.1.90]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00900  Terpenoid backbone biosynthesis
etc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETAC_01715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:etc01006]
    ETAC_01715
Enzymes [BR:etc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.90  all-trans-octaprenyl-diphosphate synthase
     ETAC_01715
Prenyltransferases [BR:etc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ETAC_01715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt DUF2291
Motif
Other DBs
NCBI-ProteinID: AGH72476
Position
complement(409664..410635)
Genome map
AA seq 323 aa AA seqDB search
MNLEQITELTAQDMADVNARILHQLNSDVALINQLGYYIISGGGKRIRPMIAVLAARALG
YQGDRHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAF
QMMTSLESLRILALMSEATNVIAEGEVQQLMNVNDPDISEENYMQVIYSKTARLFEAAAQ
CSAILAGADTAQEQALQDYGRYLGTAFQLIDDLLDYDADGKTLGKNTGDDLNEGKPTLPL
LHAMHHGSAERSAMIRQAIEQGNGRHLLEPVLETMQQAGSLDYTRSRAEEEADKAIAALA
PLPDSPHKQALIGLANLAVNRSF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagaacaaattactgagttaaccgcgcaggatatggcggatgtgaacgcgaga
attcttcaccagttaaattcagacgtcgcgcttatcaaccagcttggctactacatcatc
agcggcggcggcaaacggatccgcccgatgatcgccgtactggccgcacgcgcgctcggt
tatcagggcgatcgccacgtcaccatcgccgcgctgatcgaatttatccacaccgcgacg
ctgctgcatgacgacgtggtggatgagtcggatatgcgccgcggtaaggccaccgccaac
gcagccttcggcaatgccgccagcgtactggtcggcgactttatctatacccgcgccttt
cagatgatgaccagcctagagtcgctgcgcatcctggcgctgatgtcggaggccaccaac
gtcatcgcagagggcgaggtacagcagctgatgaacgtcaatgatcccgacatcagcgaa
gaaaactacatgcaggtgatctacagcaaaaccgcccgtctgttcgaggcggccgcgcag
tgttcggcgatcctcgccggagcagataccgcgcaggagcaagcgctacaggattacgga
cgctatctgggcaccgcatttcaactgatcgatgatttgctggactacgatgccgatggc
aagacgctgggcaagaataccggtgacgatctcaacgagggcaaaccgaccctgccgctg
ctgcacgccatgcaccacggatccgccgagcgatccgcgatgatccgccaggcgatcgag
cagggcaatggccgtcatctgctggaaccggtgctggaaaccatgcaacaggccggctcg
ctggactacacccgcagccgagcagaagaagaggccgacaaagccatcgccgccctggcg
ccgctgccggacagcccccataaacaggccctgattggactggcgaacctggccgtcaac
cgcagtttctaa

DBGET integrated database retrieval system