KEGG   Edwardsiella piscicida C07-087: ETAC_01740Help
Entry
ETAC_01740        CDS       T02509                                 

Definition
(GenBank) sensor protein BasS/PmrB
  KO
K07643  two-component system, OmpR family, sensor histidine kinase BasS [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02020  Two-component system
Module
etc_M00451  BasS-BasR (antimicrobial peptide resistance) two-component regulatory system
etc_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
etc_M00722  Cationic antimicrobial peptide (CAMP) resistance, ethanolaminephosphotransferase EptA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01740
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_01740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_01740
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_01740
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_01740
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_01740
Two-component system [BR:etc02022]
 OmpR family
  BasS-BasR [MD:M00451]
   ETAC_01740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 Bac_export_2 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AGH72481
Position
complement(413778..414851)
Genome map
AA seq 357 aa AA seqDB search
MISLRRTLLIMLALILLVTQLVSALWLWHESREQISFLVNETLSAKVRTEQVDKEIREAI
AALLIPSLVMMAVTLLLSWLAVSWIVRPLNQLQARLEKRSPSNLTPIDIDSSMTEITSIT
RTLNHLFSRLQHTLRQERLFTADAAHELRTPLAGVRLHLELMEQSGVPEATTLVQRIDQL
MHTVEQLLMLSRVGQNFASGHYPQLELISEVVLAQRSELCEMLALRGQHLRLETPSQLAM
HGDAMLLRLMLRNLVENAHRYSPEGSDILLRVTLSADEHGCILQVIDSGPGIDESRASEL
TEPFHRLDRRFGGSGLGLNIVVRILQLHKGQLTLRNNRPGPGLNACCRLPLTPQDFG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagcctgcgccgtacgctgctcattatgctggcgctgatcctgctggtcacccag
ttggtcagcgcgctgtggctatggcacgaaagccgggagcagataagctttctggttaac
gaaaccctcagcgccaaggtgcgcacggagcaggttgataaagagatccgcgaggccatt
gccgccctgctgatcccctccctggtgatgatggccgtcacgctgctgctctcctggctg
gccgtcagctggatagtccgcccgcttaaccagctacaggcgcggctagagaaacgttcg
cccagtaacctgacgcccatcgatatcgacagcagtatgacggagatcacctcgatcacc
cgtaccctcaaccacctgtttagccgcctgcagcacaccctgcgccaggagcgtctgttc
acggcggacgccgcacacgagctacgcacccccctcgccggcgtacgcctacaccttgag
ctgatggagcagagcggcgtgccggaggccactacgctggtgcagcgcatcgatcagctg
atgcacacggtcgagcagctgctgatgctgtcgcgcgtcggacagaattttgccagcggc
cattacccgcagctggagctgataagcgaggtggtgctcgcccagcgcagcgagctgtgc
gagatgctggcgctgcgtggacagcaccttcggctggagacgccgtcacagctagcgatg
cacggcgatgcgatgctgctccgcctgatgctgcgtaatctggtggagaatgcccaccgc
tacagcccagaaggcagcgatattctcctgcgggtcacgctgagcgcggacgaacacggc
tgtatcctgcaggtcatcgacagcgggcccggtatcgatgaatcgcgggccagcgagctg
accgagccctttcaccgccttgatcggcgcttcggcggcagcggcctggggctgaatatc
gtggtgcgcatcctacagctgcacaaggggcagctcaccctgcgtaataaccgcccgggg
ccggggctcaacgcctgctgccgtctgccgctgacgccgcaggatttcggttaa

DBGET integrated database retrieval system