KEGG   Edwardsiella piscicida C07-087: ETAC_01745Help
Entry
ETAC_01745        CDS       T02509                                 

Definition
(GenBank) DNA-binding transcriptional regulator BasR
  KO
K07771  two-component system, OmpR family, response regulator BasR
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02020  Two-component system
Module
etc_M00451  BasS-BasR (antimicrobial peptide resistance) two-component regulatory system
etc_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
etc_M00722  Cationic antimicrobial peptide (CAMP) resistance, ethanolaminephosphotransferase EptA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01745
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_01745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_01745
Two-component system [BR:etc02022]
 OmpR family
  BasS-BasR [MD:M00451]
   ETAC_01745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AGH72482
Position
complement(414848..415510)
Genome map
AA seq 220 aa AA seqDB search
MKILIVEDDTLIQQGLAQAMARENYACDCAGSAASASALLQSSHYSLIILDLGLPGMDGA
SALRQWRREGIDAPVLILTARDTVSDRVGGLDAGADDYLVKPFALAELLARVRALIRRMQ
GLCNNALQVDDIHLDLSSQQVSCGGLPLEITPKEFAILTRLMMRAGQTISREVLQQDLYS
WQDELSSNSLEVHIHNLRRKLGKNRIKTLRGVGYRLEKTP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattctgatcgtggaagacgataccctgatccagcagggactggcccaggcgatg
gcgcgggagaactacgcctgtgactgtgcgggcagcgcggcgagcgccagcgcgctgctg
cagagcagtcactacagcctgatcatcctcgatctggggctgcccggtatggacggtgcc
agcgcgctgcgtcagtggcgacgcgagggcatcgacgcgccggtgctgatcctgaccgct
cgggacaccgtcagcgatcgggtcggcgggctggacgccggcgccgatgactatctggtg
aaacccttcgcactggccgagctgctggcgcgcgtccgcgccctgatccgtcgcatgcag
ggactgtgcaacaacgctctgcaggtcgacgatatccatctggatctctccagccagcag
gtcagctgcggtggcctgccgctggagatcacccccaaagagttcgctatcctgacgcgc
ctgatgatgcgcgccgggcagaccatcagccgcgaagttctccagcaggatctctactcc
tggcaggatgagcttagctccaactcgctggaggtacatatccataacctgcggcgcaag
ctggggaaaaaccggatcaaaaccctgcgcggcgtcggctatcggctggagaaaacgccg
tga

DBGET integrated database retrieval system