KEGG   Edwardsiella piscicida C07-087: ETAC_01990Help
Entry
ETAC_01990        CDS       T02509                                 

Definition
(GenBank) putative aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00340  Histidine metabolism
etc00350  Tyrosine metabolism
etc00360  Phenylalanine metabolism
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc00401  Novobiocin biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ETAC_01990
   00350 Tyrosine metabolism
    ETAC_01990
   00360 Phenylalanine metabolism
    ETAC_01990
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_01990
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ETAC_01990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:etc01007]
    ETAC_01990
Enzymes [BR:etc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     ETAC_01990
Amino acid related enzymes [BR:etc01007]
 Aminotransferase (transaminase)
  Class II
   ETAC_01990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AGH72531
Position
467820..468977
Genome map
AA seq 385 aa AA seqDB search
MDRRTLLKSSVALLGALSLSGPGSLARAQSVAQRPAAPDADHPLALNFNENALGMSAQAH
QAIAAALPGAFRYPDAAREALIAALASEMALTPAHLSLGNGSSECIRAILQAQAIAAQRQ
GKAVQLVVPDPTFNYAELYLQPLGVEVVKVPLDAQLGFPLAEMQRRTRAFNGLSLVYLCN
PNNPTATLTPTDALAAWITQAPPDTFFVIDEAYAEFVNDPAFRSAVALVQAGHENLLVTR
TFSKLYALAGLRVGYGVAAPSVAAQSEALMSLDNTNSAGAAAALASLQDRAFVEHSRKTT
DLSRQIVCAALDELQLAYLPSQANFIFHQVNGDAARYQARMKQHHILVGRPFPPLNNWNR
LTLGTPQEMQLFVAQLHAFRRQGWV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtcgcaccctgcttaaatcctctgtcgccctgctgggcgcgctatcgctctca
ggcccgggctcgctggcccgggcgcagtctgtcgcccaacggcccgccgcgcccgatgct
gaccatccgctggcgctgaattttaacgagaatgctctcggtatgtcggcgcaggcgcac
caggctatcgccgccgcgctgcccggcgcctttcgttaccccgatgcggcgcgggaggcg
ctgattgccgcgctggccagcgagatggcgctgacgccggctcacctgtcgttaggcaat
ggctcctcggagtgtattcgcgccattctgcaggcgcaggcgatcgccgcacagcgccag
ggaaaggcggtgcagttggtggtgccggatcccacctttaactacgcagagctgtatctg
cagccgctgggtgttgaggtggtcaaggtgccgctggatgcgcagctggggttcccgctg
gcggagatgcagcgccgcactcgcgcctttaacggcctgtcgctggtctatctgtgtaat
ccgaataacccgacggcgacccttactccgaccgatgcgctggcggcgtggatcacccag
gcgccgccggataccttctttgtcatcgatgaggcctatgccgagttcgtcaacgatccg
gcctttcgcagcgccgtggcgctggtgcaggcggggcatgagaacctattggtgacgcgc
accttctctaagctgtatgcgctggccgggctgcgggtgggctatggggtcgcggcgccg
tcggtggccgcgcagagcgaggcgctgatgtcgctggataataccaacagcgcgggcgcc
gctgcggcgctggcctctctgcaggaccgcgcctttgtagagcacagccgtaagacgacg
gatctctcgcggcagatcgtgtgcgcggcgctggatgagctgcagctggcctatctgccg
tctcaggccaactttatttttcaccaggttaacggtgatgccgcgcgctaccaggcgcga
atgaagcagcaccatatcctggtcggccgcccattccctccgttaaataactggaaccgc
ctgacgctggggacgccgcaggagatgcagctgtttgtcgcgcagctgcacgcgttccgc
cgtcaggggtgggtctga

KEGG   Edwardsiella piscicida C07-087: ETAC_10760Help
Entry
ETAC_10760        CDS       T02509                                 

Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00340  Histidine metabolism
etc00350  Tyrosine metabolism
etc00360  Phenylalanine metabolism
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc00401  Novobiocin biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ETAC_10760
   00350 Tyrosine metabolism
    ETAC_10760
   00360 Phenylalanine metabolism
    ETAC_10760
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_10760
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ETAC_10760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:etc01007]
    ETAC_10760
Enzymes [BR:etc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     ETAC_10760
Amino acid related enzymes [BR:etc01007]
 Aminotransferase (transaminase)
  Class II
   ETAC_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C
Motif
Other DBs
NCBI-ProteinID: AGH74273
Position
2443071..2444147
Genome map
AA seq 358 aa AA seqDB search
MKPITALARENIQRLTPYQSARRLGGSGDVWLNANEYPQPVSYPLRSEAFNRYPECQPAE
LIANYAAYAGVTAQQVLVSRGADEGIELLIRTFCEPGRDAMLYCPPTYGMYAVSAETSDV
ERRCVALRADWQLDVPAIAAALDGVKLVFVCSPNNPTGNLLNPDDLRTLLTLTAGRALVI
VDEAYIEFAPDASVVSWLADYPHLVVLRTLSKAFALAGLRCGFTLASAEVIALLQKTIAP
YPLASPVADIAAQATSPAGIAAMRTRVAYVIEQRQALIAQLLRCDCIQEVYPSQGNYLIF
RSDRAGPIFQALWQQGIILRDQRRQPSLSDCLRITIGSAAEHERVLAVLRRFSQEGEA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgatcaccgcactggcgcgggaaaacatccagcgcctaaccccctaccagtcc
gcccgccgcctcggcggcagcggcgacgtctggctcaatgccaacgagtacccgcagccg
gtcagctacccgctgcgcagcgaggcctttaaccgctacccggagtgccagcccgccgag
cttatcgccaactacgccgcctatgccggcgtcacggcgcagcaggtactggtcagccgc
ggcgccgatgagggcatcgagctgctgatccgcaccttttgcgaaccggggcgcgacgcc
atgctctactgtccccccacctacggcatgtacgccgtcagcgcggagaccagcgacgtc
gaacggcgctgcgtcgcactgcgcgccgactggcagctggacgtgccggccatcgccgcc
gccctcgacggcgtcaagctggtgtttgtctgcagccccaacaacccgaccggcaacctg
ctcaatcccgacgatctgcgcacgctgcttacgctgaccgccggacgggcgctggtcatc
gtcgatgaggcctacattgagtttgcccccgacgccagcgtggtctcctggctcgccgac
tacccccatctggtcgtgctgcgcaccctctcgaaggcctttgccctggccgggctgcgc
tgcggcttcacgctggccagcgccgaggtgatcgctctgctgcagaaaaccatcgcccct
tatcctttggcatcaccggtcgccgacatcgccgcccaggcgacctcgcccgccgggatc
gccgctatgcggacgcgggttgcctacgtcattgaacagcgccaggcgctgatcgcacag
ttattgcgctgcgactgcattcaagaggtctatccttcacaggggaactatctaatcttt
cgcagcgaccgcgccgggccgatctttcaggccctgtggcagcagggcatcatcctgcgc
gatcagcgtcgccagccctcgctgagcgactgcctgcgcatcaccatcggcagcgccgcg
gagcatgagcgggttctcgcggtactgcgccgttttagccaggaaggagaggcgtaa

DBGET integrated database retrieval system