KEGG   Edwardsiella piscicida C07-087: ETAC_01995Help
Entry
ETAC_01995        CDS       T02509                                 

Definition
(GenBank) sensor protein QseC
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02024  Quorum sensing
Module
etc_M00453  QseC-QseB (quorum sensing) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_01995
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_01995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_01995
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_01995
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_01995
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_01995
Two-component system [BR:etc02022]
 OmpR family
  QseC-QseB [MD:M00453]
   ETAC_01995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N Y_Y_Y HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AGH72532
Position
complement(469005..470369)
Genome map
AA seq 454 aa AA seqDB search
MRHLSRQLTHSLRARLTGGFLILVLLVWSSASALTWYQTRDALNELFDTQQMLFAKRLLA
FDLSQLKHPLQLPQSHDLLRKHRGDQDKDALAFAIFNADGRMLLNDGDNGDNLVYRYQGD
GFTDGYLDNDDDSWRLLWLTTPDGRYRILVGQEWDYRNDMALSIVGAQMVPWLVALPVMV
ILLLLVVSRGLAPLHRLAAALRRRRPDDATPLPREAIPSEVWPVVASLNTLFARTNAQMV
RERRFTSDAAHELRTPLAALRVQAEVVQLAQDDLALRQRALGQLEQGIDRATRLVDQLLT
LSRLDSLSQLDDVQPRALAELLQTAVIDMDAKAHAAGVALALSVDDPKVCRRIQPLLFSL
LIRNLLDNAIRYSPTGSQVTLRLTSHRLQITDNGAGVSDAVLQRLGERFYRPPGQEKTGS
GLGLSIVRQIASLHGMQVQFDHAPDGGFQATLRW
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatctgtcccgccagctgacccacagcctgcgcgccaggctgaccggcggcttt
ttgatcctggtactgctggtctggagcagcgccagcgccctgacctggtatcagacgcgc
gatgcgctcaacgagctgttcgacacccaacagatgctgtttgccaagcgcctgctggcc
ttcgatctcagccagctaaagcacccgctgcagctaccgcaaagccatgatttactacgt
aaacaccgcggagatcaggacaaggacgcgctggcgttcgccatcttcaacgccgatgga
cgtatgctgctcaacgacggagacaacggcgataatctggtgtaccgctaccagggggac
ggctttaccgatggctatctggataacgacgatgacagctggcggctgctgtggctcacc
accccggacggacgctaccggattttagtcggccaggagtgggactatcgcaacgacatg
gcgctgagcatcgtcggggcgcagatggtgccctggctggtggcgctgccggtcatggtg
atcctgctactgctggtggtcagccgcggactggcgcccttgcaccgcctggcggcggcg
ctgagacgacgccgcccggacgatgccaccccgttaccccgcgaggccattcccagcgag
gtctggccggtagtcgcctcactcaacaccctatttgcccgtaccaacgcgcagatggtg
cgcgagcggcgctttacctctgacgccgcccatgagctgcgaaccccgctggcggcgctg
cgggttcaggccgaagtggtacagctggcgcaggatgatctcgccctgcgtcagcgcgcg
ctgggccagctggagcaggggatcgatcgcgcgacccgactggtggatcagctgttgacc
ctgtcgcgccttgattcactctcccagctggacgatgtgcagccgcgggcgctggccgaa
ctcctacagacggcggtgatcgacatggacgcaaaggcccatgccgcaggggtcgccctg
gcgctgtcggtggacgatcccaaggtatgccgacgtatccagccgctgctgttctccctg
ctgatccgcaacctgctggataacgcgatccgctacagcccgacgggcagccaggtcacc
ctgcggctgaccagccatcgtctgcagatcaccgataacggcgcaggcgtcagcgatgcc
gtgctacagcgcttgggcgagcgcttttaccgcccgccgggccaggagaaaaccggcagt
ggactgggactttctatcgtccgtcaaatagcctccctgcatgggatgcaggtgcagttt
gaccacgcgccggacgggggatttcaggccacgctgcgctggtaa

DBGET integrated database retrieval system