KEGG   Edwardsiella piscicida C07-087: ETAC_02000Help
Entry
ETAC_02000        CDS       T02509                                 

Definition
(GenBank) Two-component system response regulator QseB
  KO
K07666  two-component system, OmpR family, response regulator QseB
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02024  Quorum sensing
Module
etc_M00453  QseC-QseB (quorum sensing) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_02000
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_02000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_02000
Two-component system [BR:etc02022]
 OmpR family
  QseC-QseB [MD:M00453]
   ETAC_02000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg FleQ
Motif
Other DBs
NCBI-ProteinID: AGH72533
Position
complement(470369..471028)
Genome map
AA seq 219 aa AA seqDB search
MRVLLIEDDRLIGDGIKAGLSKMGFTLDWFTDGQLGMTALESAPYDAVILDLSLPGIDGL
EILRRWREAGHAEPVLILTARDALEQRVTGLQQGADDYLCKPFALIEVAARLQALIRRNH
GQAQTLLSHGAVSLDPLSLTATLDGASLPLKPKEFALLELLLRNAGRVLPRSLIEEKLYS
WDDDVSSNAVEVHIHHLRRKLGSHFIRTVHGVGYTLGDA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtactgttaattgaagacgatcgcctgattggcgacggtattaaagccggattg
agtaagatgggatttaccttggactggtttaccgacgggcagctaggcatgacggcgctg
gagagcgcgccctatgacgccgtgatcctcgacctgagcctgccgggcatcgacgggctg
gaaattctgcgccgctggcgcgaagccgggcacgcggagccggttctgatcctgaccgcc
cgcgatgccctggagcagcgagtgaccgggctacagcagggcgcagatgactatctgtgt
aagcccttcgccctgatcgaggtcgccgcacgcctgcaggcgctgatccggcgcaaccac
ggccaggcccagaccctgctcagccacggcgcggtgagcctcgatcccctgagcctcacc
gcgaccctcgacggtgcatcgctgccgctaaagcccaaggagttcgccctgctggagctg
ctgctgcgcaacgccgggcgcgtgctgccgcgctcgctgatcgaggaaaagctctacagc
tgggatgacgatgtctccagcaacgccgtcgaggtccacatccaccacctgcgccgcaag
ctgggcagccactttatccgcaccgtgcacggcgtcggctacacgctgggagacgcctga

DBGET integrated database retrieval system