KEGG   Edwardsiella piscicida C07-087: ETAC_02410Help
Entry
ETAC_02410        CDS       T02509                                 

Definition
(GenBank) RNA polymerase factor sigma-54
  KO
K03092  RNA polymerase sigma-54 factor
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_02410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:etc03021]
    ETAC_02410
Transcription machinery [BR:etc03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     ETAC_02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_DBD Sigma54_CBD Sigma54_AID
Motif
Other DBs
NCBI-ProteinID: AGH72615
Position
complement(550520..551989)
Genome map
AA seq 489 aa AA seqDB search
MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQQALESNPLLEQLEPNDEADGDS
ADDERVQDDADARDDDDPLDTRDALEQREMPDELPLDASWDEIYTAGTPSGTGTDYHDDE
LPVFQGETTQTLQDYLMWQVELTPFSETDLAIATAIVDAVDDTGYLTASLEEILESLGDE
HALPEEVEAVLKRIQRFDPVGVAARDLRDCLLVQLSQFAPDTPYLNEARSIVDRHLDLLG
NHDFRNLMRSTKLKEEVLKEAMQLIQSLDPRPGLSINTGESDYIIPDVLVHKHQGRWVVE
LNQDSVPRLHINQRYAALGAQARSDSDSQFIRSNLQEAKWLIKSLESRNDTLLKVSRCIV
EQQQAFFEHGAESMKPMVLADIAQQVEMHESTISRVTTQKFLHSPRGIFELKYFFSSHVN
TEDGGEASSTAIRALVKKLIAAENPAKPLSDSKLTTLLADQSIMVARRTVAKYRESLSIP
PSNQRKQLV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaggcttgcaactcagactcagccagcagctggccatgacgccacagctgcaa
caggctatccgcctgctgcagctctctacgctggagctacagcaagagatccagcaggcg
ctggaaagtaacccactgctggagcaactggagccgaatgacgaagccgacggcgatagc
gccgacgacgagcgcgtgcaggatgatgccgacgcacgcgatgacgacgacccgcttgat
acccgcgatgcgctagaacagcgcgaaatgccggatgagctgccgctggacgccagctgg
gatgaaatttacaccgccggcaccccctcaggaacaggaaccgactaccacgacgacgaa
ctgccggtgtttcagggggaaacgacccagaccctgcaggattacctgatgtggcaggtc
gagcttacccccttcagcgaaacggatctggccattgcgaccgccatcgtggatgccgtc
gatgacaccggctacctcacggcctcgctggaggagatcctggagagcctcggcgatgag
cacgcgctgccggaggaggtcgaagccgtcctaaagcgcattcagcgtttcgatcccgtc
ggggttgccgcccgcgacctgcgggactgcctgctggtgcagctctcccagtttgcgcca
gataccccctatttaaacgaggcgcgcagcattgtcgatcgccatctcgatctgctgggc
aatcacgatttccgaaatctgatgcgttcgactaagctaaaggaagaggtgctcaaggag
gcgatgcagctcattcagagcctcgacccgcggccagggctctcgattaataccggcgag
tccgactacattatccccgacgtgctggtccataagcaccagggacgctgggtagtcgag
ctcaatcaggacagcgtcccgcgcctgcacattaaccagcgctacgcggcgctgggcgcc
caggcacgcagcgacagcgatagccagtttatccgcagcaatctgcaggaggccaagtgg
ctgattaagagcctggaaagccgtaacgataccctgctgaaggtatcccgctgtatcgtc
gaacagcagcaggcatttttcgagcacggcgcagagtcgatgaagcccatggtgctggcc
gacatcgcgcagcaggtagagatgcatgagtcgacgatttcccgcgtgacgacgcagaag
ttcctgcacagcccgcgggggatctttgaactgaagtatttcttctccagccacgtcaat
accgaggatggtggcgaagcctcctccacggcgatccgggcactggtgaagaaactgata
gcggcggaaaatccggcgaagcctctgagcgacagcaaacttaccaccctgctggcggat
cagagtatcatggtcgcccggcgtaccgttgcaaaataccgagagtctttgtccattcca
ccgtctaaccagcgtaagcagctggtgtga

DBGET integrated database retrieval system