KEGG   Edwardsiella piscicida C07-087: ETAC_02415Help
Entry
ETAC_02415        CDS       T02509                                 

Definition
(GenBank) lipopolysaccharide ABC transporter ATP-binding protein
  KO
K06861  lipopolysaccharide export system ATP-binding protein [EC:3.6.3.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00320  Lipopolysaccharide export system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02415
Enzymes [BR:etc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     ETAC_02415
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00320]
    ETAC_02415
 Other Transporters
  Pores ion channels [TC:1]
   ETAC_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran BCA_ABC_TP_C AAA_21 SMC_N T2SSE AAA_23 AAA_30 SbcCD_C
Motif
Other DBs
NCBI-ProteinID: AGH72616
Position
complement(552114..552839)
Genome map
AA seq 241 aa AA seqDB search
MARLIAENLAKSYKGRRVVENVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGRI
IIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLEIRDDLNAEQRADRADE
LLEEFHIAHLRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII
EHLRDRGLGVLITDHNVRETLDVCERAYIVSQGNLIAYGSPDEILADEQVKRVYLGEEFR
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcaagattaattgcggaaaacctggccaagtcctataaagggcgcagggtcgtagag
aacgtcagtctgacggtaaactccggcgagatcgtcggcctgctcggcccgaacggcgcc
ggaaagaccaccaccttctacatggtggtcggtatcgtgccgcgcgatgccgggcgcatc
atcatcgatgacgatgacatcagcctgctgccgctgcacgcccgcgcccgtcgcggcatc
ggctatctgccgcaggaggcctccattttccgccgcctgagcgtttacgataacctgatg
gccgtgctggagatccgcgacgatctcaacgcagagcagcgcgccgatcgggccgatgag
ctgctggaagagtttcatatcgcccatctgcgcgataacctggggcaatccctctccggc
ggcgaacggcgccgggtggagatagcccgcgcgctggccgccaaccccaagtttattctg
ctggacgaaccctttgccggggtggatcccatctccgttatcgatatcaaaaaaattatc
gaacacctccgcgatcgcggcctcggggtgctgatcaccgaccacaacgtgcgtgaaacg
ctggacgtgtgcgagcgggcctacatcgtcagccagggtaatctgatagcctacggctct
cccgacgagatcctggccgacgaacaggtcaaacgcgtctatctgggtgaagagttccgg
ctgtaa

DBGET integrated database retrieval system