KEGG   Edwardsiella piscicida C07-087: ETAC_02455Help
Entry
ETAC_02455        CDS       T02509                                 

Definition
(GenBank) ABC transporter, periplasmic component YrbD
  KO
K02067  phospholipid/cholesterol/gamma-HCH transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00210  Phospholipid transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02455
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter [MD:M00669]
    ETAC_02455
   Phospholipid transporter [MD:M00210]
    ETAC_02455
   Mce system transporter [MD:M00670]
    ETAC_02455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaD
Motif
Other DBs
NCBI-ProteinID: AGH72624
Position
558447..558980
Genome map
AA seq 177 aa AA seqDB search
MQTKKTEVWVGLFMLIALCAAVFLCLQVANVKSLGSEPTYRLYATFDNVGGLKARSPVKI
GGVVIGRVAEISLDPQTYLPRVAMDIDQRYNHIPDTSSLAIRTSGLLGEQYLALNVGFED
PEMGTAILKDGGTIQDTKSAIVLEDLIGQFLYKSGGENGNASASTAPAGNTPAPVAH
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgaaaaaaactgaagtgtgggtcggtctgtttatgctgatcgccctgtgtgcc
gccgttttcctctgtttacaggtggccaacgtgaaatcgctggggagcgagccgacgtat
cgcctgtacgctacgtttgataacgtcggcggcctgaaggcgcgctctccggtgaaaatc
ggcggcgtcgtgattggccgggtggcggagatttcgctggatcctcagacctatctgccg
cgggtggcgatggacatcgaccagcgctacaaccatattcccgacaccagttccctggcg
atccggacctctggcctgctgggagagcagtatctggccctcaacgtcgggtttgaagat
ccggagatgggcacggcgattctgaaagacggtggcactattcaggataccaagtcagcc
atcgtgctggaggatttgatcgggcagttcctgtataagagcggcggcgagaacggtaac
gcctctgccagtaccgctcccgccggcaatacgccggcgcctgtcgcacattaa

DBGET integrated database retrieval system