KEGG   Edwardsiella piscicida C07-087: ETAC_02460Help
Entry
ETAC_02460        CDS       T02509                                 

Definition
(GenBank) ABC transporter periplasmic binding protein MlaC
  KO
K07323  phospholipid transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00210  Phospholipid transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02460
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Phospholipid transporter [MD:M00210]
    ETAC_02460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaC
Motif
Other DBs
NCBI-ProteinID: AGH72625
Position
559001..559651
Genome map
AA seq 216 aa AA seqDB search
MLKRIVMAALLCVAPWFSAQASAAPTLDQSNPYTLMNQAAAATFSRLKSEQPRIKQDPDY
LRTIVREELMPYVQVKYAGALVLGQYYRGATPAQRDAYFKAFQSYLEQVYGQALALYHGQ
RYEVAAERPLGDATIVTIRVTIFDNQGRPPVRLDFQWRKNTQTGHWQAFDMIAEGVSMIT
TKQNEWAAILREKGVDGLTQQLIVAAKQPITLDTKQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacgtattgtgatggccgcgctgctgtgcgtggcgccctggttctccgcgcag
gccagcgccgcgccgacgctggaccaaagcaacccttataccctgatgaatcaggccgcc
gccgcgacctttagccgcctgaagagcgagcagccgcgtatcaagcaggaccccgactat
ctgcgcacgatcgtgcgtgaagagctgatgccctatgtgcaggtgaagtacgccggggca
ctggtgctgggccagtattaccgcggcgcgacgccggcgcagcgcgatgcctactttaag
gctttccagagctatctggagcaggtgtatggccaggccctggcgctgtatcatggccag
cgctatgaggtggccgcagagcgtccgctgggcgatgccactatcgtgactatccgggtc
acgatctttgacaatcaggggcgcccgccggtgcgtctggacttccaatggcgtaaaaat
acccagaccggccattggcaggcgtttgacatgattgccgagggggtcagcatgatcacc
accaaacagaacgaatgggccgccattctgcgcgagaaaggggtcgatggcctgacgcag
cagctgatcgtcgcggccaaacagcccattacgctggacaccaagcagtga

DBGET integrated database retrieval system