KEGG   Edwardsiella piscicida C07-087: ETAC_02465Help
Entry
ETAC_02465        CDS       T02509                                 

Definition
(GenBank) anti-sigma-factor antagonist
  KO
K07122  phospholipid transport system transporter-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00210  Phospholipid transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02465
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Phospholipid transporter [MD:M00210]
    ETAC_02465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STAS_2
Motif
Other DBs
NCBI-ProteinID: AGH72626
Position
559648..559962
Genome map
AA seq 104 aa AA seqDB search
MTARGELRWRRVDATLYLQGALECDSLDALWQQRQTLLTGITCVDISELSRVDSAGLALL
LHVQNLRPETPIPLRGVSERLRTLITLYNLQDIVVCAAPSANLA
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgcggggtgaactgcgctggcggcgcgtcgacgcgaccctgtacctgcagggg
gcgctggagtgcgattcgctggatgcgctctggcagcagcgccagacgctgctgacgggc
atcacgtgtgtggatatcagcgagctgtcgcgggtggattcggcggggctggccctgctg
ctgcatgtgcaaaacctgcgtccggagacgccgataccgctgcggggcgtcagtgagcgc
ctgcgtaccctgataaccctgtataacctgcaggatatcgtagtgtgcgcggcgccctcg
gctaaccttgcgtaa

DBGET integrated database retrieval system