KEGG   Edwardsiella piscicida C07-087: ETAC_02555Help
Entry
ETAC_02555        CDS       T02509                                 

Definition
(GenBank) Glutamate synthase small chain
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00250  Alanine, aspartate and glutamate metabolism
etc00910  Nitrogen metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ETAC_02555
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_02555
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     ETAC_02555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_8 NAD_binding_7 FAD_binding_3 Thi4 FAD_oxidored HI0933_like K_oxygenase FMO-like NAD_binding_9 2-Hacid_dh_C AlaDh_PNT_C FAD_binding_2 GIDA ThiF DAO 3HCDH_N Fer4_7
Motif
Other DBs
NCBI-ProteinID: AGH72644
Position
complement(575982..577400)
Genome map
AA seq 472 aa AA seqDB search
MSQNVYQFIDLQRIDPPKKPLKQRQGEFIEIYEPFSDGQAQAQADRCLSCGNPYCEWRCP
LHNYIPNWLKLANEGRIWDAATLSHQTNSLPEVCGRVCPQDRLCEGACTLHDEFGAVTIG
SVERYITDKALAEGWMPDLSGVQPTGKRVAIVGAGPAGLACADVLARSGVQAELFDRHPE
IGGLLTFGIPAFKLEKQVMVRRREIFSAMGIRFHLNTEIGRDITLESLLSQFDAVFLGVG
TYQALPGGLEQEEASGVHSALPYLIATARHLMGYAEDPQTPYVSMHGKRVVVLGGGDTAM
DCVRSALRQGATQVTCAYRRDEGNMPGSRREVKNAREEGTAFRFNLQPLAIETNAAGRVC
GVRMAQTTLTDPDAAGRRAVRLVPDAEVTLAADAVILAFGFRPHAMTWLAEHGVDLDAQG
RIVAADHGDYPHQTSNPQIFAGGDAVRGSDLVVTAIAEGRRAAQGILNYLCV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaatgtctatcagtttatcgacctacagcgtatcgatccgccgaaaaagccg
ctaaagcagcgccagggcgaatttatcgagatctatgaacccttctccgacggccaggcg
caggcgcaggccgatcgctgcctctcctgcggtaacccctactgcgaatggcgctgcccg
ctgcacaattacattcccaactggctgaagctggccaacgaagggcgtatttgggatgcg
gcgacgctcagccaccagaccaacagcctgccggaggtgtgcggccgagtctgcccgcag
gatcgcctgtgcgaaggcgcctgcacgctgcatgatgagttcggtgccgtcactatcggc
agcgtagagcgctacattaccgacaaagcgctggccgagggatggatgccggatctcagc
ggcgtacagcccaccgggaaacgggtcgccatcgtcggcgccggcccggcgggccttgcc
tgtgccgacgtgctggcccgcagcggcgtacaggccgagctcttcgatcgccacccggag
atcggtggactgctcacctttggcattcccgcgtttaaattggaaaaacaggttatggtc
cgtcggcgcgagattttcagcgccatggggatccgtttccatctgaataccgagattgga
cgcgatatcacgctggagagtctgctgagccagtttgacgcggtctttctcggcgtcggc
acctaccaggccctccccggcggactggagcaggaggaggccagcggcgtacactccgcc
ctgccctaccttatcgccaccgcccgccatctgatgggctatgccgaggatcctcagacc
ccctacgtctccatgcatggcaaacgggtggtggtgctcggcgggggagacaccgccatg
gactgcgtacgcagcgccctgcgccagggggcgacccaggtcacctgcgcctatcgccgc
gatgagggcaatatgcccggctcccggcgcgaagtgaaaaacgcccgcgaagagggtacc
gcgtttcgtttcaacctgcagccgctggccattgaaaccaacgccgccgggcgggtgtgc
ggcgttcgcatggcacagacgacgctgacggatccggacgccgccggccgacgcgccgtg
cgcctcgtgcccgacgccgaggtcacgctggcggccgatgcggtgatactggcgttcggc
ttccgcccgcacgccatgacatggctggcggagcacggcgtggatctcgatgcccaagga
cgcatcgtcgccgcagaccacggcgactacccccatcagaccagtaacccgcagattttc
gccggcggcgatgcggtacgcggctccgatctggtggtgaccgccatcgcagagggacgc
cgagcggctcagggcatcctgaactatctctgcgtgtag

KEGG   Edwardsiella piscicida C07-087: ETAC_02560Help
Entry
ETAC_02560        CDS       T02509                                 

Gene name
gltB
Definition
(GenBank) glutamate synthase subunit alpha
  KO
K00265  glutamate synthase (NADPH) large chain [EC:1.4.1.13]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00250  Alanine, aspartate and glutamate metabolism
etc00910  Nitrogen metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ETAC_02560 (gltB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_02560 (gltB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:etc01002]
    ETAC_02560 (gltB)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     ETAC_02560 (gltB)
Peptidases [BR:etc01002]
 Cysteine Peptidases
  Family C44
   ETAC_02560 (gltB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG FMN_dh
Motif
Other DBs
NCBI-ProteinID: AGH72645
Position
complement(577416..581873)
Genome map
AA seq 1485 aa AA seqDB search
MLYDASHERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAILADGKTGDGCGLLLQ
KPDRFLRMVAEERGWRLAKNYAVGMLFLSRDEERASAARRIVEEELQNETLSIVGWRDVP
VNQEVLGEIALSSMPHIAQIFINAPAGWRPRDLERRLFIARRRIEKRIDDPDFYVCSLSN
LVTIYKGLCMPADLPCFYHDLADLRMESAICLFHQRFSTNTVPRWPLAQPFRYLAHNGEI
NTITGNRQWARARTYKFKTPLIPDLQDAAPFVNETGSDSSSLDNMLELLLSGGMDIVRAM
RLLVPPAWQNNPDMDPDLRAFFDFNSMHMEPWDGPAGIVMSDGRFAACNLDRNGLRPARY
VITKDRLITCASEVGIWDYQPDEVVEKGRVGPGELMVIDTRAGQILHSRETDDDLKSRHP
YREWMEKNVRRLIPFEDLPDERVGSRTLDDAALLTYQKQFAYSQEEIDQILRVLGENGQE
ATGSMGDDTPFAVLSSRPRLIYDYFRQQFAQVTNPPIDPLREAHVMSLSTSIGREMNVFC
EAEGQAHRLNFKSPVLLYSDFAQLIGQEKEHYRAETLDITFDPEQQDLQQALAALCDEAE
AQVRRGAVLLVLSDRAISARRLPIPAPMAVGAVQRRLVEQSLRCDANIIVETAGARDPHH
FAVLLGFGATAIYPYLAYETLAKLVDSGAIARSYRQVMLNYRNGINKGLYKIMSKMGIST
VASYRCSKLFEAVGLHPAICDLCFPGVISRIGGATFSDFQQDLHNLSRRAWLARQPLEQG
GLLKYVHDGEYHAYNPDVVQALQQAVQSGDYRDYQRYASLVNQRPITTLRDLLALRPVAQ
PLALEQVEAESALFQRFDTAAMSIGALSPEAHEALAQAMNGLGGFSNSGEGGEDPARYNT
DKASRIKQVASGRFGVTPAYLVNADVIQIKVAQGAKPGEGGQLPGDKVTPYIARLRYSVP
GVTLISPPPHHDIYSIEDLAQLIFDLKQVNPRALISVKLVSEPGVGTIATGVAKAYADLI
TIAGYDGGTGASPLSSVKHAGCPWELGLVETQQALVANGLRHKIRLQVDGGLKSGADIIK
AAILGAESFGFGTGPMVALGCKYLRICHLNNCATGVATQDEKLRRDHFHGLPLRVTHYFH
FIARETRELMAQLGVSRLVDLIGRTDLLTVLEGVTAKQSRLDLAPLLHTATPHPGKGLYC
SEGNPPFDPGQLNQSLLSQLQDNIATRQGRALFCDIHNTDRSVGAALSGAIAERYGEQGM
AASPLKIQFSGTAGQSFGVWNAAGLELTLTGDANDYVGKGMAGGRIVIRPPVGSAFRSHE
ASIIGNTCLYGATGGKLFAAGRAGERFAVRNSGALTVVEGIGDNGCEYMTGGIVCVLGRT
GINFGAGMTGGFAYVLDEDGEFRQRVNAELVEVLEMAALPIHEEHLRGLITEHVRLTGSG
RAEAILADWPQWAARFVLIKPKSSDVKALLGHRSRSAAELRVQAQ
NT seq 4458 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacgatgcatcccatgaacgggacaactgcggcttcggcctgattgcccatata
gaaggcgaaccgagtcataaggtcgtgcgtaccgccatccatgcgctggcgcgcatgcag
caccgcggtgccatcctggccgacggcaaaaccggcgacggctgcggcctgctgttacaa
aagcccgatcgcttcctgcgcatggtggcagaagagcgtggctggcgactggccaagaac
tatgccgtcggcatgctgttcctcagccgcgacgaagagcgggccagcgccgcccggcgc
atcgttgaggaggagctacaaaacgagactctctccatcgtggggtggcgcgacgtcccc
gtcaatcaagaggtgctgggtgagatcgcactctcttccatgccgcatatcgcgcaaatc
ttcatcaatgctccggccggatggcgcccgcgggatctggagcgccggctgtttatcgcc
cgccgacgcatagaaaagcgcatcgacgatccggatttctatgtctgcagcctctcgaat
ctggtcaccatctacaaagggctgtgcatgccggccgatctgccgtgcttttaccacgac
ttggccgacctgcgcatggagtcggctatctgcctgttccaccaacgcttctcgaccaac
accgtgccacgctggccgctggcgcagccgtttcgctatctggcgcacaacggcgaaatc
aacaccattaccggtaatcgtcagtgggcacgggcgcgtacctacaaatttaagacgccg
ctgatccccgatctgcaggacgcagccccctttgtcaacgaaaccggctccgactccagc
tccctcgataacatgctggagctgctgttaagcggggggatggacattgtgcgcgccatg
cgtctgctggtgccgccggcctggcagaacaacccggacatggaccccgacctacgcgcc
ttcttcgactttaattcgatgcatatggagccctgggatggcccggccggcatcgtgatg
tcagacggacgcttcgccgcctgtaacttagatcgcaacggcctgcgtccggcgcgctat
gtaataaccaaagacaggctgatcacctgcgcctcagaggtgggcatctgggactatcag
ccggatgaagtggtggagaaagggcgcgtcggccccggcgagctgatggtgatcgacacc
cgtgccgggcagatcctgcactcgcgggaaaccgacgacgatctgaaaagccgccatccc
tatcgcgaatggatggagaaaaacgtccgacgtctaatcccctttgaggatctgcccgat
gagcgagtcggcagccgcacgctggacgatgcggcgctgctcacttaccaaaaacagttt
gcctacagtcaggaagagatcgaccagatcctgcgggtgctgggggaaaacggccaggag
gcgacgggctcaatgggcgatgatacgccctttgccgtcctctccagccgcccgcgcctc
atctatgattacttccgtcagcagttcgcccaggtcaccaatccgccgatcgatccgctg
cgcgaagcccacgtcatgtcgctctctaccagcatcgggcgcgaaatgaacgtcttctgc
gaagccgagggacaggcgcatcgccttaactttaagtcgccggtgctgctctactctgac
ttcgcccagctgatcgggcaggagaaagagcactatcgcgccgaaaccctggatatcacc
ttcgatcccgagcaacaggatctgcaacaggccctcgccgccctgtgcgacgaggccgag
gcccaggtccgccgcggcgcggtgctgctggttctgtccgatcgcgccatcagcgcccgg
cgtttgccgatccctgcgccgatggccgtcggggcggtgcagcggcgcttggtcgaacag
agcctacgctgcgacgccaacatcatcgtcgaaaccgccggcgcgcgcgatccgcatcac
tttgccgtgctgcttggctttggcgccaccgcaatctacccctacctggcctatgaaacc
ttggccaaactggtggacagcggagccatcgcgcgcagctatcgccaggtcatgctgaac
taccgcaacgggatcaataaagggctgtacaagatcatgtccaaaatgggcatctcaacg
gtggcctcttaccgctgctccaagctgtttgaggccgtcggccttcaccccgcgatctgc
gatctgtgcttccccggggtcatcagccgcatcggtggagcgaccttcagcgacttccag
caggatctgcataatctgtcccgccgggcctggctggcacgccagcccttggagcagggg
ggactgctgaagtatgtccacgacggtgagtatcacgcttacaaccccgacgtggtgcag
gccctgcagcaggcggtgcagagcggcgactatcgcgactaccagcgttacgctagcctg
gtcaatcagcgcccgatcaccaccctgcgcgatctgttggcgctgcgccccgtcgcgcag
cccctggcgctggagcaggttgaggcggaaagcgccctgttccaacgcttcgatacggcg
gccatgtccatcggcgcgctgagccccgaggcccacgaggcgctggcccaggcgatgaac
ggcctgggcggcttctctaactccggcgagggcggcgaggatccggcgcgctacaacacc
gataaagcctcgcgtatcaagcaggtcgcctctggacgcttcggcgtcacgcccgcctat
ctggtcaacgccgatgtgatccagattaaagtggcgcagggcgccaagccgggcgaaggg
gggcaactgcccggcgataaggtgacgccgtacattgcccgactgcgctattcggtgccc
ggcgtcacgctgatctctcccccgccgcaccacgatatctattccatcgaagatctggca
cagctgatcttcgatctcaaacaggtcaatccgcgggcgctgatctccgttaagctggtc
tctgaaccgggagtgggcaccatcgcgaccggagtcgccaaggcctatgccgatctgatc
accatcgcgggctatgacggcggcaccggcgccagcccgctctcctccgtgaaacacgcg
gggtgcccctgggagctcggcctggtggagacccagcaggcgctggtggccaacggactg
cgccataagatccgcctgcaggtggacggcggcctgaagagcggcgccgatatcatcaag
gccgcgatcctcggcgcggaaagcttcggcttcggcaccggtcccatggtggcgctgggc
tgcaaatatctgcgtatctgccacctcaataactgcgctaccggcgtcgccacccaggat
gaaaagctgcgccgcgaccacttccacggcctgccgctgcgcgtgacccactacttccac
tttattgcgcgggaaacccgcgagctgatggcgcagctgggcgtcagccgcctggtggat
ctgatcggccgcaccgatctgctgacggtgctggagggagtgaccgccaagcaaagccgc
ctggacctggcgcctctgctccatacggccacgccgcatccgggcaaggggctgtactgc
agcgaaggtaacccccccttcgatccgggacagctcaaccagagcctgctgtctcagcta
caggacaatatcgcgacccgtcagggacgcgcgctattctgtgatatccataacacggat
cgctcggtgggcgccgcgctttccggcgccatcgccgaacgctacggtgagcagggaatg
gccgcctcgccgctgaaaatccagtttagcggtaccgcaggccagagctttggcgtgtgg
aatgccgcgggccttgagctgaccctgaccggtgatgccaacgactatgttggaaaaggc
atggcgggcggccgtatcgtcatccgcccgccggtcggctccgccttccgcagccatgag
gccagcatcatcggcaacacctgtctgtacggcgccaccggcggtaagctgttcgccgcc
gggcgcgccggcgagcgctttgccgtgcgtaactccggcgcgctcaccgtcgttgagggg
atcggagataacggttgtgaatacatgaccggcggtatcgtctgcgtgttaggccgcacc
ggtatcaactttggcgcgggcatgaccggtggctttgcctatgtgctcgatgaggacggc
gaattccgccaacgcgtcaacgccgagctggttgaggtgctggaaatggcggcgctgccg
atccacgaggagcacctgcgcgggctgatcaccgaacacgttcggctgacgggatccggg
cgcgcagaggccattctggccgactggccgcagtgggccgcgcgctttgtcttaatcaag
cccaaatccagcgacgtgaaagcgctgctgggacaccgtagccgctccgcagccgagctg
cgcgtacaggcacaataa

DBGET integrated database retrieval system