KEGG   Edwardsiella piscicida C07-087: ETAC_02570Help
Entry
ETAC_02570        CDS       T02509                                 

Definition
(GenBank) aerobic respiration control sensor protein ArcB
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00456  ArcB-ArcA (anoxic redox control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_02570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_02570
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_02570
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_02570
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_02570
Two-component system [BR:etc02022]
 OmpR family
  ArcB-ArcA (no operon) [MD:M00456]
   ETAC_02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HKR_ArcB_TM HATPase_c Response_reg PAS PAS_4 HisKA Hpt PAS_9 PAS_8 HATPase_c_3 Exonuc_VII_L CCB1 7tm_7 Syntaxin_2 DUF3086 RapA_C
Motif
Other DBs
NCBI-ProteinID: AGH72647
Position
583648..585984
Genome map
AA seq 778 aa AA seqDB search
MKQIRVLAQYYVDLMVKLGLVRFSILLASALVLLAMVVQMAVTMLLRGQVDSIDVVRSVF
FGLLITPWAVYFLSVVVEQLEESRQRLSKLVNKLEEMRHRDLKLNQQLKDNISQLNQEIA
DRVKAEEARLQVLDTLQHEIDQRELAQVELEQQSALLRSFLDSSPDLVYYRNEDGEFSGC
NRAMELLTGKSEKQLIGLTPRDVYDPDIAQKVIETDEKVFRHNVSLTYEQWLVYPDGRKA
CFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASREKTTFISTISHELRTPLNG
IVGLSRILLDTELNEEQLKYLKTIHVSAIALGNIFNDIIEMDKLERRKVQLDNQAIDFTG
FLTDLENLSGLLVQPKGLSFTLTPDPALPHKVMADGTRLRQILWNLIGNAVKFTQRGGVS
VRVWREQQDKLLFEVRDTGIGIPPEEQDKIFAMYYQVKDMHGGKPATGTGIGLAVSKRLA
QTMGGDIVVSSVAGEGACFTLSIRAPVVEEALSEPPAEEEMPLPALHVLLVEDIELNVIV
ARSVLEKMGNSVDVAMSGAEALAMFAPQEYDLVLLDIQLPDMTGLDIARTLCQRYGKPAL
PPLVALTANVLKDKKEYLDAGMDDVLSKPLAVPALTAVIRRFWDSAPATTLEAGEPHAHD
LCELLDTEMLQQYLDLVGPQLIDQSLAVFEKMMPGYLSVLESNMTARDQKGITEEGHKIK
GAAGSVGLRHLQQLAQQIQTPTLPAWWDNVQEWIDELKQEWRHDVQVLRDWVAQANKK
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattcgggtattggcccagtattacgttgatttaatggtaaaacttgggctg
gtgcgcttctccatcctattggcatcggcgctggtgctgctggccatggtggtgcagatg
gcggtgaccatgctcctgcgtggtcaggtggacagcatcgacgtggtgcgctcggtcttc
tttggcctgctgatcaccccctgggccgtctatttcctgtcggtggtggtggagcagctg
gaggagtcgcgtcagcgcctgagtaagctggtgaataagctggaggagatgcgccaccgc
gatctgaagctgaaccagcagctcaaggacaatatcagccagcttaaccaagagattgcc
gatcgcgtcaaggccgaagaggcccgtctgcaggtgctggataccctgcagcacgagatc
gatcagcgcgagctggcgcaggtagagctggagcagcagtcggcgctgctgcgctcattc
ctcgactcctctccggatctggtctactaccgcaatgaagacggtgagttttccggctgc
aatcgggcgatggagctgctgaccggtaagagtgaaaagcagctgatcggactgacgccg
cgcgacgtgtacgatccggacatcgcccagaaggtcatcgagaccgatgagaaggtcttc
cgccataatgtttccctcacctacgagcagtggctggtctatcccgacgggcgtaaggcc
tgcttcgagctgcgcaaggtgcccttctatgatcgggtgggtaagcgccacggcctgatg
ggctttgggcgcgatattacggagcgcaagcgctatcaggatgccctggagaacgcaagc
cgtgaaaaaaccacctttatctcgaccattagccatgagctgcgcaccccgctgaacggg
atcgtcggcctcagccgtattctgctggataccgagctgaatgaggagcagctgaaatac
ctgaagaccatccacgtcagcgcgatagcgctggggaatattttcaatgacatcattgag
atggataaacttgagcggcgcaaggtacagctggataaccaggctatcgattttaccggc
tttctgacggatctggagaatctgtccgggctcttggttcagccgaaggggctgagcttt
acgctgacgccggatcccgcgctgccgcataaggtgatggcagacggaacgcgcctgcgc
cagatcctgtggaacctgatcggcaacgcggtcaagttcactcagcgcggcggcgtcagc
gttcgcgtctggcgtgagcagcaggataagctgctgtttgaggtgcgcgataccggcatc
ggtattcctccggaggagcaggataagatcttcgccatgtactatcaggtgaaagatatg
cacggcggcaaaccggccaccggcaccggcattggcctggcggtctccaagcgtctggcg
cagaccatgggcggcgatatcgtggtgagcagcgtggcgggcgagggggcctgctttacc
ctgagcatccgtgcgccggtcgtcgaagaggcgctgagcgagccacccgcggaagaggag
atgccgctgccggcgctgcacgtcctgctggttgaggatattgaactgaatgtgatcgtc
gcgcgctcggtgctggagaagatggggaacagcgtcgatgtggcgatgagcggcgccgag
gcgctggccatgtttgcgccgcaggagtatgacctggtgctgctggatattcagctgccg
gatatgaccggcctggatatcgcccgcacgctgtgccagcgctatggaaaaccggcgctg
ccgccgctggtggcgttgacggcgaatgtcttgaaagataagaaagagtacctggacgcc
gggatggatgatgtgctgagcaagccgctggcggtaccggcgctgacggcggtgatccgc
cgcttctgggacagtgctccggcgacgacgctcgaggcgggtgagccccatgcgcacgat
ctctgtgagctgctggataccgagatgctgcagcagtatctggatctggtcgggccgcag
ctgatcgatcagagcttggcggtattcgagaagatgatgccgggctatctgtcggtgctg
gagtccaatatgaccgcgcgcgatcagaaagggattaccgaagagggacacaagattaaa
ggcgccgcaggctccgtgggactgcgtcatttacagcagctggcgcagcagattcagacg
ccgacgctgccggcctggtgggacaatgtgcaggagtggatcgacgaactgaagcaggag
tggcgccacgacgtgcaggttctacgcgactgggttgcgcaggctaataaaaaatga

DBGET integrated database retrieval system