KEGG   Edwardsiella piscicida C07-087: ETAC_02615Help
Entry
ETAC_02615        CDS       T02509                                 

Gene name
serB
Definition
(GenBank) phosphoserine phosphatase
  KO
K01079  phosphoserine phosphatase [EC:3.1.3.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_02615 (serB)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_02615 (serB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:etc01009]
    ETAC_02615 (serB)
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     ETAC_02615 (serB)
Protein phosphatases and associated proteins [BR:etc01009]
 HAD phosphatases
  Other HAD phosphatases
   ETAC_02615 (serB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5609 Hydrolase HAD Hydrolase_3 S6PP Put_Phosphatase CHASE4
Motif
Other DBs
NCBI-ProteinID: AGH72656
Position
593622..594599
Genome map
AA seq 325 aa AA seqDB search
MPNSLTFCDLPAEIYRWPGLPLSLSGDEVMPLDYRAGHTGWLLYGRHLDKAALQAFQRRL
AAPLVVVAAWCIEDYQVVRLAGGMPARAAKLANEQGIDTAVLGRLPHLRSPGLLVMDMDS
TAITIECIDEIARLAGVGGEVAAVTERAMRGELDFAASLRQRVAALEGADAAILQQVRDD
LPLMPGLTSLVRKLQAFDWHVAIASGGFTYFADHLRTRLNLSAAVANALEVHNGRLTGRV
TGRIVDAQCKEDTLCELAQRLNIPLTQTVAIGDGANDLKMIQRAGLGIAFHAKPCVYDRA
PLAIRHADLIGVLCVLSATLKHEER
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacagtcttaccttttgcgatctgcccgcggagatttatcgctggcccggcctg
ccgctgtcgctgagcggtgatgaggtaatgcctttggactatcgcgccggtcacaccggc
tggctgctgtacggacgtcatctggataaggcggcgctgcaggcgttccagcgccgtctg
gcggcgccgctggtggtggtggccgcgtggtgcatcgaggactatcaggtggtgcgcctg
gccggcggtatgcctgccagggcagccaagcttgccaatgagcagggtatcgacaccgcg
gttttggggcgtctgccgcacctgcgctcgccggggctgctggtgatggatatggactca
acggccattaccatcgagtgtatcgacgagatcgcgcgtctggccggggtcggcggagag
gtggccgccgtgaccgagcgcgccatgcgcggcgagctggactttgccgccagcctgcgc
cagcgcgttgcggcgctggagggggccgacgccgccatcctgcagcaggtcagggatgac
ctgccgctgatgccgggactgaccagcctggtgcgtaagctgcaggcgtttgactggcat
gtggcgattgcctccggtggctttacctattttgccgatcacctgcgtacgcgtttgaat
ttgagcgccgcggtggccaacgcgctggaggtgcacaacgggcgcctgaccggtcgggtt
acggggcggatcgtggatgcgcagtgcaaagaggataccctgtgcgagctggcgcagcgg
ctgaatatcccgttaacccagaccgtcgccatcggcgatggtgcgaacgatttgaagatg
atccagcgtgcagggctggggatcgcattccatgccaagccctgcgtctacgatcgggcg
ccgttggcgattcgtcatgcggatctcatcggtgtcctgtgcgtgctgagcgcgacgtta
aagcatgaagagcgttag

DBGET integrated database retrieval system