KEGG   Edwardsiella piscicida C07-087: ETAC_02645Help
Entry
ETAC_02645        CDS       T02509                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K15634  probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00260  Glycine, serine and threonine metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00002  Glycolysis, core module involving three-carbon compounds
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_02645
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_02645
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_02645
Enzymes [BR:etc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     ETAC_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGH72662
Position
601202..601849
Genome map
AA seq 215 aa AA seqDB search
MRQVYLIRHGETEWNVQRRIQGQSNSPLTVMGEQQARQVGARLGQMGITHVIASDLGRTQ
QTGEIIAAACRCPLTLDARLRELSMGVLESRLLASLSPQEEQWRLSMLDGSPQGCIPQGE
TMAQLAERMQQALNDCLALPQGSRPVLVSHGIALGCLLSTVLGLPPYAERRLRLRNCSLS
RVDYQQSAWLASGWVVETAGDVQHLAQPSMDEVLR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagacaggtatatcttattcgtcacggcgaaacggagtggaacgtacagcggcgtatt
cagggacagtcgaacagcccgctgaccgtgatgggcgaacagcaggcgcggcaggtcggc
gcgcgcttagggcagatgggcataacccacgtgatcgccagcgatctggggcgcactcag
cagacgggggagatcatcgccgcggcctgtcgctgtccgctgacgctggatgcccgtctg
cgcgagctgagcatgggggtgctggagtcgcgtctgttggcctcgctgtcgccgcaggag
gagcagtggcgcctgagcatgctggatggttcgccgcagggctgtattccgcagggggag
accatggcgcagctggctgagcgcatgcagcaggcgctgaacgattgcctggcgctaccg
caggggagccgtccggtgctggtgagccatggcattgccctgggctgcctgctctccacg
gtgctgggactgccgccgtacgctgagcgccgcctgcgcctgcgcaactgctcgctgtcg
cgggtggactatcagcagagcgcatggctggcgagcggatgggtggtcgaaacggcgggg
gatgtacagcatctggcccagccgtcgatggatgaagtgttacgttag

KEGG   Edwardsiella piscicida C07-087: ETAC_12340Help
Entry
ETAC_12340        CDS       T02509                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00260  Glycine, serine and threonine metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00002  Glycolysis, core module involving three-carbon compounds
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_12340 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_12340 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_12340 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etc04131]
    ETAC_12340 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_12340 (gpmA)
Enzymes [BR:etc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ETAC_12340 (gpmA)
Membrane trafficking [BR:etc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ETAC_12340 (gpmA)
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ETAC_12340 (gpmA)
  Exosomal proteins of melanoma cells
   ETAC_12340 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGH74589
Position
2779295..2780047
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNRENRFTGWTDVELSEKGRQEARAAGRLLKAQGFSFDVAYTSVL
KRAIHTLWHVLDEIDQPWLAVEKSWKLNERHYGALQGLNKAETAQQYGDEQVKLWRRAFA
ITPPALTPDDPRYPGHDPRYAALSADELPLTESLATTIERVIPYWQQQIAPRIAAGERII
IAAHGNSLRALVKHLDHLSESEIIELNIPTGVPLVYEFDADMQPLRHYYLGDADEIAARQ
NAVANQGKAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaccaaactggttctggtccgtcacggcgaaagcgagtggaaccgggaaaac
cgcttcaccggctggaccgacgttgaactgtcagagaaagggcgccaagaggcgcgggcg
gcgggtcgccttctgaaggcgcagggattttcctttgacgtcgcctacacctccgtgctc
aagcgcgccattcacaccctgtggcacgtactggatgagatcgatcagccgtggctcgcg
gttgaaaaatcatggaagctcaatgagcgccactacggcgccctgcaggggctgaacaag
gcggagaccgcgcagcagtacggcgacgaacaggtcaagctgtggcgccgcgcctttgcc
atcaccccaccggccctgacgccggacgatccccgctatcccggccacgatccgcgctat
gcggccctaagcgccgacgagctcccgctgacggagagcctggccaccaccattgagcgg
gtgatcccctattggcagcagcagatcgcgccgcgcatcgccgccggcgagcggatcatc
atcgccgcccacggcaattcgctgcgcgcgctggtcaagcatctggatcatctgagcgaa
agtgagattatcgagctgaatatcccgaccggggttccgctagtgtatgagtttgacgcc
gatatgcagccgctgcgccactactaccttggcgacgccgacgagattgccgcccgccaa
aacgccgtcgccaatcagggcaaggcgggctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_16630Help
Entry
ETAC_16630        CDS       T02509                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00260  Glycine, serine and threonine metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00002  Glycolysis, core module involving three-carbon compounds
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_16630
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_16630
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_16630
Enzymes [BR:etc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     ETAC_16630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme iPGM_N Sulfatase
Motif
Other DBs
NCBI-ProteinID: AGH75447
Position
3744028..3745572
Genome map
AA seq 514 aa AA seqDB search
MSNAKKPMVLVILDGYGYREDQQDNAILNAKRPVMNRLWAEYPHTLISASGLDVGLPDGQ
MGNSEVGHVNLGAGRIVYQDLTRLDKEIKEGDFYNNAALTRAVDDAVAAGKAVHIMGLMS
PGGVHSHEDHILAMVDLAAQRGAEAIYLHAFLDGRDTPPRSAESTLKRFTDHFAAIGKGR
IASLIGRYYAMDRDNRWDRVELAYDLLTDAKGEFHADNAIDGLQAAYARGENDEFVKPTV
IRAAGQADAAMQDGDALIFMNFRADRARQITRAFVNADFDGFARRKIVKLGSFVMLTEYA
ADIKTECAYPPASLSNTLGEWLMKHNKTQLRISETEKYAHVTFFYNGGVEDPFNGEDRIL
INSPKVATYDLQPEMSSAELTEKLVSAIGSGKYDTIICNYPNGDMVGHTGVYDAAIKAVE
ALDACMGQVVDAVQKADGQLLITADHGNAEMMRDQESGQPYTAHTNLPVPLIYIGKQASA
VEGGKLSDIAPTMLTLMGMDVPQEMTGKPLFIVK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgccaaaaaaccgatggttctggtgatccttgacggctatggttaccgtgaa
gatcagcaggacaacgcaattctcaacgctaagcgtccggtgatgaatcgcctgtgggct
gaatatccgcatacgctgatctccgcatccggtctggatgtcggcctgccggatggtcag
atgggcaactccgaagtcggtcacgtcaacctgggcgccgggcgcatcgtataccaggat
ctgacccgtctggacaaagagatcaaagagggcgacttctacaacaatgccgcgctgacc
cgcgccgtagatgatgccgttgccgccggtaaggccgtgcacatcatgggcctgatgtcc
cctggcggcgtacacagtcacgaagaccatatcctggcgatggttgatctggcagcccag
cgcggcgcagaggccatctatctgcacgctttcctcgatggtcgcgacaccccaccgcgt
agtgcggaatcaacactgaaacgattcactgaccatttcgccgcaatcggtaaagggcgc
attgcctcactgatcggtcgttactacgccatggatcgcgacaaccgttgggatcgcgtc
gagctggcctacgatctgttgaccgacgccaagggtgaattccacgccgataacgccatt
gatgggctgcaggccgcctacgcccgcggtgaaaacgacgagtttgttaagccgaccgta
attcgcgccgcaggccaggccgacgccgcgatgcaggatggcgacgcgctgattttcatg
aacttccgcgctgaccgcgcacgccagatcacccgcgcattcgttaacgctgacttcgac
ggcttcgcccgccgcaaaatcgttaagctgggcagctttgtcatgctgaccgagtatgcc
gccgatatcaagaccgaatgcgcctacccgccggcttcgctgagcaataccctgggtgag
tggctgatgaagcacaataaaactcagctgcgcatctccgaaaccgaaaaatacgctcac
gtcaccttcttctataacggtggcgtagaagatccgttcaacggtgaagatcgcatcctg
atcaactcaccgaaagtggcgacctacgatctgcagccggagatgagttcggccgagctg
accgaaaagctggtctccgccatcggcagcggcaagtatgacaccatcatctgtaactat
ccgaacggcgacatggttggccacaccggcgtttacgacgcggcgatcaaggccgtcgag
gcgctggacgcctgcatgggtcaggtcgttgacgccgtgcagaaggccgatggtcagctg
ctgatcactgccgaccacggtaacgcggagatgatgcgcgatcaggagagcggtcagccg
tatacggcgcacactaacctgccggtaccgctgatctacatcggtaagcaggccagcgct
gtcgagggcgggaaactgtccgacatcgctccgaccatgctgaccctgatggggatggat
gtcccacaagagatgactggcaagccgctgttcatcgtgaaataa

DBGET integrated database retrieval system