KEGG   Edwardsiella piscicida C07-087: ETAC_02670Help
Entry
ETAC_02670        CDS       T02509                                 

Definition
(GenBank) RcsF
  KO
K06080  RcsF protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsF
Motif
Other DBs
NCBI-ProteinID: AGH72667
Position
complement(606027..606449)
Genome map
AA seq 140 aa AA seqDB search
MRALPLCLLTASLALSGCSLLSRPAAPIKPLAADRTPETVAKPRAVTPRQTPITLYESAE
DLIGKPFRDLGEVSGSVCQTRPHHSAPSLTTARKRMLYKAAQLKANAVLLHSCQILSQSH
GCYRQATCTGSALSIATPAQ
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattaccgttatgcctgcttacggccagtcttgcgctaagcggctgctctctg
ctgtcacgcccggccgccccgatcaagcccctggccgcagacagaacgccggaaaccgtc
gccaagccacgcgccgttacgccgcgtcagacgccgattacgctgtatgagagcgctgaa
gatctgatcggcaaaccctttcgcgatctcggcgaagtcagcggcagcgtttgtcagacc
cgcccccaccatagcgccccgagcctgactactgcgcgtaaacgcatgctatataaggct
gctcagctaaaggcaaacgccgtgctgctgcacagctgccagatccttagccagagccat
ggctgctatcgccaagccacctgtaccggctccgccctcagcattgccaccccagcccaa
tga

DBGET integrated database retrieval system