KEGG   Edwardsiella piscicida C07-087: ETAC_02675Help
Entry
ETAC_02675        CDS       T02509                                 

Definition
(GenBank) methionine ABC transporter substrate-binding protein
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02675
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238]
    ETAC_02675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_9 OpuAC Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AGH72668
Position
complement(606560..607375)
Genome map
AA seq 271 aa AA seqDB search
MSTKFTSLALVGTLLGTLALAGCGQEEKDPNHIKVGVIVGAEQQVAEVAQKVAKDKYGLN
VELVTFNDYVLPNEALNKGDIDANAFQHKPYLDQQIKDRGYKLVAVGNTFVYPIAGYSKK
IKSLNELQDGAQIAIPNDPTNLGRSLLLLQSVGLIKLKDGIGLLPTVLDITENPKHLKLV
ELEAPQLPRSLDDNQIALAVINTTYASQIGLTPAKDGIFVEGKDSPYVNLIVAREDNKDA
ENVKKFVQAYQSDEVYNAANKIFNGGAVKGW
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaaattcacgtccctggcactggtcggcacattactcggcacgctggcactg
gctggctgtggacaggaagagaaagatcctaaccatatcaaggtcggcgttatcgtcggc
gcggagcagcaggttgccgaagtcgctcagaaggtggccaaagacaaatacggtttgaac
gtcgaactggtgacctttaacgactacgtcctgcccaacgaagcgctgaacaaaggcgac
attgatgccaacgccttccagcataaaccctacctcgatcagcagattaaagatcgaggc
tataagctggtcgcggttggaaataccttcgtttacccgatcgcaggctactctaaaaag
attaagtcactgaacgagctgcaggacggcgctcaaatcgccattccgaacgatccgacc
aacctgggtcgctccctgctgctgctgcaaagcgtaggattgattaagctgaaagatggc
atcggcctgctgccgacggtgctggatatcacggaaaacccgaagcatctgaagctggtt
gaactggaagccccccagctgccgcgctccctggacgacaatcagatcgcgctggccgtc
attaacaccacctatgccagccagattggtctgacgccggcaaaggacgggatcttcgtc
gaagggaaagactccccctacgttaacctgatcgtcgcgcgtgaagacaataaagatgct
gagaacgtgaaaaaattcgttcaggcctatcaatctgatgaagtgtataacgcagcaaac
aaaatctttaacggcggggcagtaaaaggctggtaa

DBGET integrated database retrieval system