KEGG   Edwardsiella piscicida C07-087: ETAC_02680Help
Entry
ETAC_02680        CDS       T02509                                 

Definition
(GenBank) DL-methionine transporter permease subunit
  KO
K02072  D-methionine transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02680
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238]
    ETAC_02680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 YwiC
Motif
Other DBs
NCBI-ProteinID: AGH72669
Position
complement(607438..608091)
Genome map
AA seq 217 aa AA seqDB search
MSEAMMWLMVRGIWETVVMTLVSGFFGFVIGLPVGVLLYTSRPGQILENARLYKLLSALV
NIFRSIPFIILLVWMIPFTRLIVGTSIGLQAALVPLTIGAAPFIARMVENSLLEIPSGLI
EAARAMGATPMQIVNKILLPEALPGLINAATITLITLVGYSAMGGAVGAGGLGQIGYQYG
YIGYNATVMNTVLVLLVVLVYLIQFSGDRIVKAISRK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggcaatgatgtggttaatggtccgcggcatctgggaaaccgtcgtcatgacc
ctggtctccggtttctttggctttgtcatcgggctgccggtcggcgtgctgctgtacacc
tcgcgcccaggacaaattctggaaaatgcgcggctgtataagctgctgtccgcactggtt
aatatctttcgctccatcccattcatcatcctgctggtctggatgatcccgtttactcgc
ctgatcgttggcacctctatcggtctgcaggcggcgctggttcccctgaccatcggcgcg
gcgcccttcattgcccgaatggtggaaaacagcctgctggagatcccaagcggcctgatt
gaagcggcgcgggcaatgggagcgaccccgatgcagatcgtcaataagatcctgctgccg
gaggcgctgccggggttgattaacgcggcgaccattacgctgatcacgctggtaggctac
tcagcgatgggaggggcggtcggtgccggtggtctcggacagatcggctaccagtacggt
tatatcggttacaacgcgacggtaatgaatacggtattagtattgctggtcgttttagtg
tatttgattcagttcagcggtgaccgcatcgtcaaggcgatcagccgtaaataa

DBGET integrated database retrieval system