KEGG   Edwardsiella piscicida C07-087: ETAC_02685Help
Entry
ETAC_02685        CDS       T02509                                 

Definition
(GenBank) methionine ABC transporter ATP-binding protein
  KO
K02071  D-methionine transport system ATP-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_02685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_02685
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238]
    ETAC_02685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran NIL AAA_21 AAA_22 SMC_N AAA_16 AAA_29 RsgA_GTPase TniB SbcCD_C DUF3652
Motif
Other DBs
NCBI-ProteinID: AGH72670
Position
complement(608084..609115)
Genome map
AA seq 343 aa AA seqDB search
MIKLTHITKVFQQGQRRISALDDVSLHVPAGQIYGVIGSSGAGKSTLIRCVNLLERPTQG
QVFVDGQDLTAMSTGQLTRTRRQIGMIFQHFNLLSSRTVYGNIALPLELDRVPRDEITRR
VTELLALVGLADKRDAYPANLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRAIL
ELLKDINRRLGLTILLITHEMDVVKRICDQVAVISQGKLIEQGSVGEVFSHPKTPLAQQF
IHATLHLDIPDDFAERMTPTRGADSQPLLRLEFTGQSVDAPLISQAVRRFNVDISILSSQ
MDYAGGVKFGVMLAEVHGDDADAQAAIAFFEQHHVKVEVLGYV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaactcactcatatcaccaaggtattccagcaggggcagcgccgtatcagcgcg
ctggacgacgtgtcgctgcacgtgcccgccggacagatttacggcgtaatcggttcgtcc
ggcgcgggtaaaagcaccctgatccgctgcgtcaatttactcgagcgtccaacgcaggga
caggtattcgtcgacgggcaggatctgacggcgatgagcaccggacagctgacgcgtacg
cgccgccaaatcggcatgattttccaacacttcaatttactctcctcgcggacggtctat
ggcaacatcgccctgccgctggagctggatcgcgtgccgcgcgacgagatcacgcgccgg
gttaccgagctgctggcgttggtcggtctcgccgacaagcgcgatgcttaccccgccaac
ctctccggcggtcagaaacagcgcgtggcgatcgcccgtgcgttggccagcaaccccaaa
gtgctgctgtgcgacgaagccaccagcgcgctggatccggccaccactcgcgcgattctg
gagctgttaaaagatatcaaccgccgtctggggctgaccatcctgctgatcacccatgag
atggacgtggtcaaacgtatctgcgatcaggtcgccgttatcagtcagggaaagctgatc
gaacagggcagcgtcggcgaggtgttctctcatcccaagacgccactggcccagcagttt
atccacgccacgctgcatctggatatcccggatgactttgcagagcggatgacgcccacc
cgcggcgccgatagccagccgctgctacgcctggagttcaccggccagtcggtcgatgcg
ccgctgatttcacaggcggtgcggcgttttaatgtcgacatcagcattctcagctcccag
atggattatgccggcggagtgaagtttggcgttatgttggccgaagtccacggcgacgat
gccgatgcccaagccgctatcgccttttttgaacagcatcacgtgaaagttgaggtactg
ggttatgtctga

DBGET integrated database retrieval system