KEGG   Edwardsiella piscicida C07-087: ETAC_02725Help
Entry
ETAC_02725        CDS       T02509                                 

Definition
(GenBank) two-component response regulator
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00456  ArcB-ArcA (anoxic redox control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_02725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_02725
Two-component system [BR:etc02022]
 OmpR family
  ArcB-ArcA (no operon) [MD:M00456]
   ETAC_02725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AGH72678
Position
complement(624068..624784)
Genome map
AA seq 238 aa AA seqDB search
MQTPHILIVEDELVTRNTLKSIFEAEGYIVHEANDGAEMHQILSEFDINLVIMDINLPGK
NGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNLGSGTEERKSVEHYRFNGWELDINSRSLVSPDGEQYKLPRSEFRAMLHFCENPGKIQ
SRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRFCGDLEE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgcacattctgatcgtcgaggacgaactcgtcactcgtaatacgttaaaa
agtattttcgaagcggaaggttatatcgttcatgaagccaatgatggtgccgagatgcat
cagattctgtctgagttcgacatcaatctggtcatcatggacatcaacctgcctgggaaa
aacggcctgttactggcgcgcgaactgcgtgaacaggcaaatgtcgcgctgatgttcctg
accggtcgcgataacgaagtggacaaaatcctcggtctggaaatcggcgccgacgactat
atcaccaaaccgtttaacccccgtgaactgaccatccgtgcccgtaacctgctctcccgc
accatgaacctgggcagcggaaccgaggagcgtaaaagcgttgagcactatcgctttaac
ggttgggagctggacatcaacagccgctcgctggtcagccccgacggcgagcagtacaag
ctgccgcgcagcgagttccgcgccatgctgcacttctgcgagaacccgggcaagattcag
tcacgcgccgagctgctgaagaagatgaccggccgtgagctgaagccgcacgatcgtacg
gtcgatgtcacgatccgccgcattcgcaagcactttgaatccacgccagacacgccggag
atcatcgccactatccacggcgaaggctaccgcttctgcggcgatctggaagagtaa

DBGET integrated database retrieval system