KEGG   Edwardsiella piscicida C07-087: ETAC_02735Help
Entry
ETAC_02735        CDS       T02509                                 

Gene name
thrA
Definition
(GenBank) bifunctional aspartokinase I/homoserine dehydrogenase I
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00261  Monobactam biosynthesis
etc00270  Cysteine and methionine metabolism
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
etc_M00017  Methionine biosynthesis, apartate => homoserine => methionine
etc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_02735 (thrA)
   00270 Cysteine and methionine metabolism
    ETAC_02735 (thrA)
   00300 Lysine biosynthesis
    ETAC_02735 (thrA)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ETAC_02735 (thrA)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     ETAC_02735 (thrA)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     ETAC_02735 (thrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh AA_kinase NAD_binding_3 ACT_7 ACT
Motif
Other DBs
NCBI-ProteinID: AGH72680
Position
626509..628971
Genome map
AA seq 820 aa AA seqDB search
MRVLKFGGTSVANAERVFSVADILESNAAQGQVAAVLSAPARITNHLVALIERTIAGQDI
QPILGDAEKIFTDLIDGLAQAQPGFDAAPLRLRVSQEFGQIRQVLHGIALLGQCPDSVNA
ALICRGEALSIAIMAALLRARGRQVTVIDPVSSLLARGGYLESSVDIAESARRIAAQAIP
ADSLILMAGFTAGNERGELVVLGRNGSDYSAAVLAACLRAACCEIWTDVDGVYTCDPRLV
PDARLLESMSYQEAMELSYFGAKVLHPRTISPIAQFQIPCLIKNTANPQAPGTLIGAQRR
GDDALPVKGITHLNHMAMLNVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSIS
FCVPQGELARACQALQDEFFLELKDGLLEPLDVIEHLAIISVVGDGMRTQRGISAKFFSA
LARANINIVAIAQGSSERSISVVVNNDAATTAVRVTHQMLFNTDQVIEVFVIGVGGVGGA
LLAQIERQQAWLKSKHIDLRVCGIANSRALLTHVHGIDMANWRGALEQASQPFNLGRLMR
LVNEYHLLNPVIVDCTSSQALADQYADFLGNGFHVVTPNKKANTASLDYYRLLRQKAAGS
QRKFLYDTNVGAGLPVIENLQNLLSAGDELQRFCGILSGSLSFIFGRLEEGATFSQATRE
ARQLGYTEPDPRDDLSGMDVARKLLILAREAGYALELDDICVEPVLPAAFDARGDVDTFL
ANLAQADDAFSARVAAAQARGCVLRYVGEIDQGRCAVRIAEVDSDDALYKVKNGENALTF
YSRYYQPLPMVLRGYGAGNDVTAAGVFADLLRTLSWKLGV
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgagagtattaaaattcggtggcacgtcggtcgccaacgcggagcgggtcttcagcgtt
gccgatattttggagagtaacgccgcacagggacaggtcgccgccgtgctttccgccccg
gcccgcatcaccaaccatctggtggcgctgattgaacgcaccatcgcagggcaagatatc
caaccgatactcggcgacgccgagaagatttttaccgatctgatcgatggcttagcccag
gcgcagccgggcttcgacgccgcaccgctgcgtctgcgcgtgtctcaggagtttggccag
atccgccaggtgctgcacggcatcgccctgctgggacagtgtccagatagcgttaatgcg
gcgctgatttgccgcggagaggcgctctccatcgcgatcatggcggcgctgctgcgcgcg
cgcggacgtcaggttaccgttatcgatccggtcagcagtctgctggcccgcggcggctat
ctggagtccagcgtcgatatcgcggagtccgcccgccgtatcgccgcccaggcgatcccg
gccgacagcctgatcctgatggcggggttcaccgccggtaacgagcgcggcgagctggtg
gtactgggacgcaacggctcagactattcggcggcggtgctggccgcctgcctgcgcgca
gcgtgctgcgagatctggacggacgttgacggcgtgtatacctgcgatccgcgtctggtt
ccggacgcacgtctactggagtcgatgtcctaccaagaggcgatggagctctcctacttt
ggcgccaaggtgctgcacccgcgcaccatttcaccgattgcgcagtttcaaattccctgc
ctgatcaaaaataccgccaacccgcaggcgcccggtaccctgatcggcgcgcagcgccgc
ggtgatgacgcgctgccggtgaaggggatcacccatctgaaccatatggcgatgctcaat
gtctctgggccggggatgaaagggatggtcggcatggcggcgcgggtcttcgccgtgatg
tcgcgtagcggtatttccgtggtgttgataacccagtcctcctctgaatacagcatcagc
ttttgcgtgccgcagggggagctggcgcgggcctgccaggcgctgcaggatgagttcttc
ctggagctgaaggatggcctgctggagccgctggatgttatcgagcatctggcgatcatc
tcggtggtcggcgacggtatgcggacccagcgcggcatttcggccaagtttttctcggct
ctggcgcgggcgaacatcaacattgtcgcgattgcgcagggctcctctgagcgctcgatc
tccgtcgtggtgaacaatgatgcggcgacgaccgccgtgcgtgtgacgcaccagatgcta
ttcaacaccgatcaggtgatcgaggtgtttgttatcggcgtaggcggcgtggggggcgcg
ctgttggcgcagattgagcgtcagcaggcctggctgaaaagtaagcatatcgatctgcgg
gtgtgcggcatcgcgaactcccgtgcgctgctgacccatgtacacggtatcgatatggcg
aactggcgtggggcgctggagcaggcctcgcagccgtttaacctggggcgcctgatgcgt
ctggtgaacgagtatcacctgctgaatccggtgatcgtcgactgtacctccagccaggcg
ttggccgatcagtacgctgacttcctcggtaacggttttcacgtggtgacgccgaataaa
aaggccaatacggcttccctggattattaccgcctgctgcgtcagaaggcggcgggcagt
cagcgcaagtttctctacgataccaacgtcggggccgggctgccggtgatcgaaaacctg
caaaatctgctgagcgccggcgatgagctgcagcggttctgcggcattctctccggttcg
ctgtcgtttatctttggccgcttggaggagggggcgaccttctcacaggcaacccgtgaa
gcgcgtcagctgggctataccgaaccggatccgcgtgatgatctctccggcatggacgtg
gcgcgcaagctgctgatcctggcgcgtgaggcgggatatgccctggagctggacgatatc
tgcgtcgagccggtgctgccggcggcgttcgatgcccgcggtgacgtcgatacgttcctc
gccaatctggcgcaggcggatgacgcgtttagcgcgagggttgccgctgcgcaagcgcgt
ggctgcgtgctgcgctacgtcggcgagatcgatcaggggcgctgcgcggtgcgcattgcg
gaggtagacagcgatgatgcgctgtataaggttaaaaatggcgaaaacgccctgacgttt
tacagccgttactatcagccgctgccgatggtgctacgcggctatggcgcgggtaacgat
gtcaccgccgccggcgtctttgccgatctgctgcggaccttgtcatggaagctgggagtt
taa

KEGG   Edwardsiella piscicida C07-087: ETAC_16265Help
Entry
ETAC_16265        CDS       T02509                                 

Gene name
metL
Definition
(GenBank) bifunctional aspartate kinase II/homoserine dehydrogenase II
  KO
K12525  bifunctional aspartokinase / homoserine dehydrogenase 2 [EC:2.7.2.4 1.1.1.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00261  Monobactam biosynthesis
etc00270  Cysteine and methionine metabolism
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
etc_M00017  Methionine biosynthesis, apartate => homoserine => methionine
etc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_16265 (metL)
   00270 Cysteine and methionine metabolism
    ETAC_16265 (metL)
   00300 Lysine biosynthesis
    ETAC_16265 (metL)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ETAC_16265 (metL)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     ETAC_16265 (metL)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     ETAC_16265 (metL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh AA_kinase NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGH75374
Position
complement(3683025..3685463)
Genome map
AA seq 812 aa AA seqDB search
MSAQAVTGQQQAERQLHKFGGSSLADVKCYLRVAGIMAEYSRPGDMMVVSAAGSTTNQLI
SWLKLSQSDRISAHQVQQALRRYQSELIAGLLPPEMAEPLQAHFIRDLERLAALLDSEID
EAAYAEVVGHGEIWSARLMAAVLQTQGMASAWLDARDFLRAERAAQPQVDEGRSYPLLQQ
QLAQHPNKRLVVTGFISRSGAGETVLLGRNGSDYSATQIGALAGVRRVTIWSDVAGVYSA
DPRKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSASDIDLQLRCSYQPQQGSTRI
ERVLASGNGAKIVTSHDDVCLIELHVPAGHEFSHVHQEVERILTRSQLRPLASGIHRDRG
LIQLCYTAEVVGSVFKLLEESAIPGLLQLRDGLALVAMVGAGVCRNPLHAHRFYQQLKDQ
PVEFIWQSEESISLVAVLRCGPTEALVQGLHSSLFRAEKRVGLVLFGKGNIGSRWLELFA
REQGNLSARSGFEFILAGVVDSNRSLLNYEGLDASRALAFFDDEAQALDEESLFLWMRAH
PYDDLVVLDVTASPSLAQQYRDFASYGFHVVSANKLAGAADGHEYRQIRDAFEKTGRHWL
YNATVGAGLPVNYTVRDLRDSGDTILSISGIFSGTLSWLFLQFDGSVPFSALVDQAWQQG
LTEPDPRVDLSGQDVMRKLVILAREAGYDIEPAQVRVESLVPVGGEQGSIDHFFENGEAL
DEQMLQRLEAANEMGLVLRYVARFDANGKARVGVEAVRPEHPLASLLPCDNVFAIESRWY
RDNPLVIRGPGAGRDVTAGAIQSDLNRLARLL
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacaagcggtaacggggcagcaacaggcagagcgccagctgcataagttcggc
ggcagtagcctggcagacgtaaagtgttatttgcgcgtagcggggatcatggcggaatac
agccgccccggcgacatgatggtcgtgtcggcggcgggcagcaccaccaatcagctgatc
agctggctcaagctcagccagagcgatcgcatctctgcccatcaggtacagcaagccctg
cgccgttaccagagtgaactgattgccggtttgctgccgccggagatggcggagccgctg
caggcgcactttattcgggatcttgagcgcctggccgcgctgctggatagcgagatcgat
gaggcggcctacgccgaggtcgtgggccacggtgagatttggtccgcccggctgatggcg
gcggtgctgcagactcagggaatggcgtcggcgtggctggatgcgcgggatttcttgcgc
gccgagcgcgccgctcagccgcaggtggatgaggggcgctcctatccgctgctgcagcag
caactggcccagcatccgaataagcgtctggtggtaaccggttttatcagccgcagcggc
gcaggtgaaacggtcttgctgggccgtaacggttctgactattcggcgacgcagatcggc
gccttggccggcgtgcggcgcgtgactatctggagcgatgtcgccggggtctacagcgcc
gatccgcgtaaagtgaaagatgcctgtctgctgccgctgctgcgtctggatgaggccagc
gagctggcgcgtttggccgcgccggtgctgcacgcccgtacgctgcagccggtgtccgcc
agcgatatcgatctgcagctgcgctgcagctatcagccgcagcaggggtcgacccgcatt
gagcgggtgctggccagcggcaacggcgccaagattgtcaccagccatgacgatgtctgc
ctgattgagctgcacgttcccgctggtcatgagttcagccacgtacaccaagaggtggag
cgtattctgacgcgcagtcagctgcgcccgctggccagtgggattcatcgcgatcgcgga
ctgatccagctgtgctacaccgcagaggtggtcggcagcgtatttaagctgctggaggag
tcggcgattccggggctgctacagctgcgcgacggcttggcgctggtggcgatggttggc
gccggcgtctgccgcaatccactgcatgctcaccgtttttatcagcagcttaaggatcag
ccggtcgagtttatctggcagtcggaggagagcatcagcttggtggcggtgctacgctgt
ggcccgacggaggcgctggtacaggggctgcacagctcgctgttccgggcagaaaaacgc
gtcggtctggtcctgtttggtaagggcaacatcggttcccgctggctggagctgttcgct
cgcgaacagggtaacctgtcggcgcgcagcggtttcgagtttattctggccggggtggtc
gacagcaatcgcagcctactgaactatgaggggctggacgccagccgcgcgctggccttc
tttgacgatgaggcgcaggcgctggatgaagagtcgctgttcctgtggatgcgggctcat
ccctatgatgatttggtggtgctcgatgtgacggccagtccttcgctggcccagcagtac
cgtgattttgccagctacggtttccacgtggtcagcgccaacaagctggccggcgccgcc
gacggccatgaataccgtcagatccgcgacgcatttgagaaaaccggacgccactggctg
tataacgcgaccgtgggcgccgggctgccggttaactataccgtgcgcgatctgcgcgac
agcggcgatacgattctgtccatcagcggcattttctccggcaccctctcctggctgttt
ctgcagtttgacggttcggttccctttagcgcgctggtggatcaggcctggcagcagggg
ctgacggagcccgacccgcgggtggacctttccggccaggatgtgatgcgcaagctggtg
atcctggcgcgcgaggcggggtatgacattgagcccgcccaggtccgggtcgagtccctg
gtgccggtcggcggcgagcagggttctatcgatcacttttttgagaacggcgaggcgctg
gacgagcagatgctgcagcgtctggaagcggccaatgagatggggctagtgctgcgctac
gtggcgcgctttgacgccaacggtaaggcgcgcgtcggcgttgaggccgtgcgcccggag
cacccgctggcgtcgcttttgccgtgcgacaacgtgttcgcgatcgaaagccgctggtat
cgcgataatccgctggtgatccgcggccccggcgcggggcgcgatgttaccgccggcgcc
atccagtcggatcttaaccgtctggcgcgtctgctttag

DBGET integrated database retrieval system