KEGG   Edwardsiella piscicida C07-087: ETAC_02740Help
Entry
ETAC_02740        CDS       T02509                                 

Definition
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01230  Biosynthesis of amino acids
Module
etc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_02740
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     ETAC_02740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AGH72681
Position
628973..629902
Genome map
AA seq 309 aa AA seqDB search
MVKIYAPASIGNVSVGFDVLGAAVTPLDGTLLGDCVSVEASDRFALHCRGRFVDSLPAAA
QENIVYQCWQRFCEVTGRELAVEMVLEKNMPIGSGLGSSACSVVAALAALNRFAGDPLDA
QRLLTLMGELEGRISGSVHYDNVAPCYLGGLQLMLEAQGIISQPVPCFDDWLWVMAYPGI
KVSTAEARAILPPHYSRGDCVRHGRHLAGFIHACHTRQPSLAAALMQDVIAEPYRCGLLP
GFADARRAAGELGALACGISGSGPTLFAVCDDPAAAQAVAQWLTQHYLQNEQGFVHICRL
DTAGARQLG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaatatatgcgccggcctccatcggcaacgtcagcgtcggttttgacgtcctg
ggcgccgcggtaacgccgctggacggcacgctgctgggcgactgcgtcagcgtggaggcc
agcgaccgttttgcgctgcactgccgcggacgcttcgtcgacagtctgccggcagccgct
caggagaacattgtctatcagtgctggcagcgcttctgtgaggtgacggggcgtgagctc
gccgtcgagatggtgttggaaaagaacatgccgataggttcaggcctcggctcgagcgcc
tgctccgtggtggcggcgctggcggcgctgaaccgttttgccggcgatccgctggatgcc
cagcggctgttgacgctgatgggagagctggaggggcgtatttccggcagcgtccactat
gacaacgtcgcgccctgctatctgggcggtctgcagctgatgctggaggcgcaggggatc
atcagccagcccgtgccctgctttgacgactggctgtgggtgatggcgtatcccgggatc
aaggtctctactgccgaagcgcgcgccatcctaccgccgcactactcacgcggcgactgc
gtgcgccacggccgccatttggcggggttcattcatgcctgccatacccgccagccgtcg
ctggccgcggcgctgatgcaggatgtgatcgccgaaccctaccgctgtggcctgctgccg
ggctttgccgatgcccgccgggccgccggtgagctgggcgcgttggcctgcgggatctcg
ggctccggcccgacgctgtttgccgtctgtgatgatccggcggcggcgcaggcggtggcg
cagtggctaacgcagcactatctgcagaatgaacagggctttgttcacatttgccgtttg
gacacggcgggcgcacgacaactgggataa

DBGET integrated database retrieval system