KEGG   Edwardsiella piscicida C07-087: ETAC_02745Help
Entry
ETAC_02745        CDS       T02509                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00750  Vitamin B6 metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01230  Biosynthesis of amino acids
Module
etc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_02745
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ETAC_02745
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ETAC_02745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AGH72682
Position
629906..631192
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVNFAQALVQGLGRQQGLFFPHALPALARAQIDALLEQDFVTRSAHILA
AYLGDEFPFETLRDRVQAAFDFPAPVVPVSDDIAALELFHGPTLAFKDFGGRFMAQMLQQ
VAGDRPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKVSPLQEKLFCTLGGNIRTL
AIEGDFDACQALVKQAFDDPTLCRELGLNSANSINISRLLAQICYYFEAVAQLPQAARNQ
LVISVPSGNFGDLTAGLLAQSLGLPVKRFIAATNANDTVPRFLSSGVWQPHETVATLSNA
MDVSRPNNWPRVEELFRRREWSLGALGYGALSDAQTAAAMRELAALGYVSEPHAAIAYRA
LRDDLQPGEYGLFLGTAHPAKFQESVEAILQRSIPLPQALAARAALPLLSQTLPADFSRL
RAALLDRP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaatttaaaagatcacaacgagcaggttaactttgcgcaggcgctggtg
caggggctggggcgccagcagggactgttctttccccatgcgctgcccgccctggcgcgg
gcgcagatcgatgccctgctggagcaggattttgtaacccgcagcgcgcatattctggcg
gcgtatctgggggatgagttcccctttgagacgctgcgcgatcgggtgcaggccgccttc
gacttccctgcgccggtggtgccggtcagcgatgatatcgctgcgctggagctgtttcat
gggccgacgctggcgttcaaggactttggcgggcgctttatggcgcagatgctgcagcag
gtcgcaggggatcggccggtgaccattctgaccgccacctccggcgataccggcgccgcg
gtcgcccatgcgttttatggtctgaaaaacgtccaggtggtgatcctctacccgcgcggc
aaggtcagtccgctgcaggagaagctgttctgtaccctgggcggcaatattcgtacgctg
gcgatcgagggcgacttcgatgcctgccaggcgctggtcaaacaggcgtttgacgatccg
acgctgtgccgtgagctggggctaaactcggctaactctatcaatatcagccggctgctg
gcgcagatctgctactactttgaggcggtagcccagctgccgcaggcggcgcgcaatcag
ctggtgatctcggtaccgagcggcaacttcggcgatctgaccgccgggctgctggcccag
tcgctggggctgccggtgaagcgttttatcgccgcgaccaatgccaatgataccgtgccg
cgtttcttatccagcggcgtctggcagccccatgagaccgtcgcgaccctctccaatgcc
atggacgtcagccgtcccaacaactggccgcgggtggaagagctgttccggcgtagagag
tggtcgctgggcgcgctgggctacggggcgctgagcgatgcgcagaccgcggcggcgatg
cgtgagctggcggcgctcgggtatgtcagcgaaccccatgccgctatcgcctatcgagcg
ctgcgtgacgatctgcagcccggcgagtatggcctgtttctgggaaccgcccatccggcc
aagttccaagagtctgttgaagcgatcctgcagcggagcatcccgctaccgcaggcgttg
gcggcgcgggctgcactgccgctgctgtcacagacgctgcccgccgacttttcccgcctg
cgggcggcactgctggatcgcccataa

DBGET integrated database retrieval system