KEGG   Edwardsiella piscicida C07-087: ETAC_02760Help
Entry
ETAC_02760        CDS       T02509                                 

Definition
(GenBank) transaldolase B
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
etc_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_02760
Enzymes [BR:etc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     ETAC_02760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA DUF3052
Motif
Other DBs
NCBI-ProteinID: AGH72685
Position
634023..634976
Genome map
AA seq 317 aa AA seqDB search
MTDKLTSLRQLTTVVADTGDIAAMKQYQPQDATTNPSLILNAAQIPEYRKLIDDAIAWAR
AQSGDRAQQIVDASDKLAVNIGLEILKLIPGRISTEVDARLSYDTEASVAKAKRLIKLYN
DAGISNDRILIKLASTWQGIRAAERLEKEGINCNLTLLFSFAQARACAEAGVFLISPFVG
RILDWHKANGDKSEFAPAEDPGVISVTEIYNYYKQHGYETVVMGASFRNVGEILELAGCD
RLTISPSLLKTLSESTGSVERKLAYQGEVKARPARMSEAEFYWQHNQDPMAVEKLADGIR
KFAVDQGKLESMIGALL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaactgacctccctgcgtcaactgaccaccgttgtcgctgatactggcgat
atcgccgcgatgaagcagtatcagcctcaggatgccacgactaacccctctctgatcctt
aacgccgcgcaaattccggaataccgtaaactgatcgacgatgccattgcctgggctcgt
gcccagagcggcgatcgcgcgcagcagatcgtggatgcctcagacaagctggcggtaaat
atcggtctggagatcctcaagctgatcccgggccgcatctccactgaagtggacgcccgt
ctttcctatgacaccgaagccagcgtggcgaaggcgaagcgcctgatcaagctgtataac
gatgccggcatcagcaacgatcgtatcctgatcaagctagcctcaacctggcagggcatc
cgcgccgcggagcgcctggagaaagagggcatcaactgtaacctgaccctgctgttctcc
tttgctcaggcccgtgcctgcgccgaagccggcgtgttcctgatttcaccgtttgtcggc
cgtattctggactggcataaggctaacggagacaagagcgagttcgccccggcagaagat
ccgggcgtgatttccgttactgaaatctataactactataaacagcacggctatgaaacc
gtggtgatgggcgcgagcttccgcaacgtcggcgagatcctggagctggccggctgcgat
cgcctgaccatctcgccatcgctgctgaaaacgctgtctgaaagcaccggtagcgttgag
cgtaagctggcttaccagggcgaagtcaaggctcgcccggcgcggatgagcgaggctgag
ttctactggcagcataaccaggatccgatggcggtagagaaactggcggacggtatccgc
aagttcgccgttgaccagggtaagctggaaagcatgatcggcgcgctgctgtaa

DBGET integrated database retrieval system