KEGG   Edwardsiella piscicida C07-087: ETAC_02845
Entry
ETAC_02845        CDS       T02509                                 

Definition
(GenBank) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_02845
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AGH72702
Position
complement(653388..653873)
AA seq 161 aa
MNVKEWVEICCQINGKNYQFCVSPAMSLLEMLREHGLTSVKQGCCVGECGACSVLIDGVA
TDSCLYLALWADGKQIVTAEGLGRTDSLSPIQQAYVDAGAVQCGFCTPGLVVATHALLAK
PRSRPLTHEEIRRGLSGNLCRCTGYQAIVRAVDLCQREEEQ
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaatgtcaaagagtgggttgaaatctgctgccagatcaatgggaaaaactatcagttt
tgcgtatcgccggcgatgtcactgctggaaatgctgcgcgagcacgggctaaccagcgtg
aagcagggctgctgcgtcggcgaatgcggcgcctgcagcgtattgatcgatggcgtggca
accgacagctgcctgtatctggcgctgtgggccgacggtaagcagatcgtcacggccgaa
gggctggggcgaaccgacagcctttcaccgatccagcaggcctatgtcgacgccggcgcc
gtgcagtgcggcttctgtaccccgggactggtggtcgcgacccatgccctactggcgaaa
ccgcgcagccgcccgctgacgcacgaagagatccgccgcggcctctccggtaacctgtgc
cgctgcaccggctatcaggccatcgtacgcgccgtcgatctctgccagcgcgaagaagag
cagtaa

DBGET integrated database retrieval system