KEGG   Edwardsiella piscicida C07-087: ETAC_02855
Entry
ETAC_02855        CDS       T02509                                 

Definition
(GenBank) xanthine dehydrogenase subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_02855
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ETAC_02855
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AGH72704
Position
complement(654755..657046)
AA seq 763 aa
MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGNVTAIDTREAESMPGV
EAVFTFHDIPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFGDGVAIVVARDLLSAER
AAARVQVSYEALPVITRPLAALADNAPAIHPGGNLLRHSEIDAGEPDARMAAADLQLEGH
YETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTVAQALGLPWSHVRVIKPYV
GGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVATRTRHAFSIDARLGMRRDGQ
LEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFGYCADTVYTNLPAAGAMRGYG
APQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNPVNGKTIYSAGLTECLEKGRRL
FEWDQRRAECLAQPADAPVRRGVGVACFSYGSNTYPVGVEIAGARLLLNQDGTVNLQIGA
TEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDITAFDPGAFASRQSYVAAPAIRRAA
EIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPDQVLMSVADVAMQAYYHQEIGAQIL
AEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRILNLHDSGRILNPQLAEGQVHGGMGM
GIGWALFEEMIIDEKSGVVRNPNLLDYKFPTCVDLPDLECAFVETVEPQSAYGHKALGEP
PIISPGPAIRNAIRMATGVAINALPITPKTLYREFVQAGLIRE
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgtctttaggatcgccgctgcggcgggttgatgccgaagccaaggtcaccggacaggcg
cgttataccgatgatatgatgatgcccggcatgctccatgcctgctacgtgcgcagccgt
atcgcccatggtaacgtcaccgccatcgatacccgggaagcggagtccatgcccggcgta
gaagccgtcttcacctttcacgatatcccctcagcccctttccctaccgccggccatgcc
tggtcgctggagccgggcaaacgggatatcgccgatcgccatctgctgaccggccacgta
cgccactttggcgatggcgtcgccatcgtcgtcgcccgcgatctgctcagcgccgagcgc
gccgcggcgcgggtacaggtcagctatgaggcgttgccggtgatcacccgaccactggcg
gccctggccgataatgcgccggccattcaccccggcggcaatttactgcgtcacagcgag
atcgacgccggagagcccgatgctcgcatggccgccgccgatctgcagctggagggacac
tacgagacgccggtggtgcagcactgccacatggagggtgtgacctgctatgcctatatg
gagcagcccgatcacatcgtcattgtctccagcacccaaattccccagattgtccgccgc
accgtcgcccaggccctcggtctcccctggtcgcacgtccgagtgatcaagccctacgtc
ggcggcggattcggcaataagcaggatgtgctagaagagcccatggccgcctttttaacc
cagcgcctcggcggtaaaccggtcaaggtcagcctaagccgcgaggagtgcttcgtcgcc
acccgcactcgccatgccttcagcatcgatgccaggctgggcatgcgtcgggatggacaa
ctggagggctaccggcttacggtgctgtccaacaccggcgcctatgcctctcacggccac
tcgatcgccgccgccggcgccaataaaatcagctatctctatccccgcagcgcctttggc
tactgcgccgatacggtatataccaacctgcccgccgccggtgcgatgcgcggctacggc
gcgccgcaggtcgactttgccctggaatgcctgatggacgacgccgcagcccgtctcgat
ctcgaccccctcgaggttcgtctgcgcaacgtcgcgcgtcagggggaccgcaacccggtt
aacggcaagaccatctacagcgccgggctcaccgaatgcctggaaaaaggccgccgcctg
tttgagtgggatcagcgccgcgccgaatgtctggcccagccggccgatgcgccggtgcgg
cgcggcgtcggcgtcgcctgtttcagctatggctccaatacctatccggttggggtggag
atcgccggcgcccgcctgctgctcaatcaggacgggacggtaaacctgcagattggcgcc
accgaaatcggccagggatccgacaccgtcttcgcccagatggcatcggagacgctgggg
atcccctttaaacagatccgggtgatctcaactcaggataccgatatcaccgccttcgat
cccggcgcctttgcctcacggcaaagctacgtcgccgccccggcgatccgccgagcggcg
gagatcatgcgccagaagatcctggcgcacgcggcgctgataagccaccagccggagtgg
ggattgaccctgtgcgacggtaacgtcgtgatggcgatgcagccggatcaggtgctgatg
agcgtcgccgatgtcgccatgcaggcttactaccatcaggagatcggcgcgcagatcctg
gccgaggtctcccataaaaccaccaccaatcccccggccttcggctgcacctttgtcgat
ctcagcatcgatatcgcgctgtgccaagtcaccattaaccgcatcctgaatctgcatgac
tccgggcggatcctcaacccgcagctggcggaggggcaggtgcacggcggcatgggaatg
gggatcggctgggcgctgttcgaagagatgatcatcgatgagaagagcggcgtggtacgc
aacccgaatctgctcgactacaaattccccacctgtgtcgatctgccggatctggagtgc
gcctttgtcgagaccgtggagccgcagtcggcctatggccacaaggcgctgggtgagccg
ccgatcatttcgcctggaccggcgatccgcaacgccattcgcatggcaacgggggtcgcg
atcaatgcgctgccgatcacccccaaaacgctgtatcgcgaatttgtgcaggccggactg
atcagggagtaa

DBGET integrated database retrieval system